IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of nerve growth factor complexed with the shared neurotrophin receptor p75. Structure of nerve growth factor complexed with the shared neurotrophin receptor p75. Science (0036-8075) 2004 He XL., Garcia KC. Apoptosis - Interactions involving proteins with a function related to apoptosis PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined He XL., Garcia KC. Apoptosis - Interactions involving proteins with a function related to apoptosis Science (0036-8075) 2004 ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA DIP protein P01138 original sequence version: 170 DIP protein P01138 original sequence version: 144 DIP protein P01138 original sequence version: 121 DIP protein P01138 original sequence version: 172 619DFC65EB3BD671 tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV DIP protein P07174 original sequence version: 124 DIP protein P07174 original sequence version: 106 B2E152D94D3827F8 ngfb-ngfr-1 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain uniba unidentified baculovirus direct interaction direct interaction trimeric, multimeric working 75.700%, free 73.100% 2.4A