IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ X-ray structure of the FimC-FimH chaperone-adhesin complex from uropathogenic Escherichia coli. X-ray structure of the FimC-FimH chaperone-adhesin complex from uropathogenic Escherichia coli. Science (0036-8075) 1999 Choudhury D., Thompson A., Stojanoff V., Langermann S., Pinkner J., Hultgren SJ., Knight SD. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Choudhury D., Thompson A., Stojanoff V., Langermann S., Pinkner J., Hultgren SJ., Knight SD. PDBe - Data obtained from the Protein Data Bank Europe Science (0036-8075) 1999 fimc_ecoli Chaperone protein FimC fimC b4316 JW4279 protein protein ecoli Escherichia coli (strain K12) MSNKNVNVRKSQEITFCLLAGILMFMAMMVAGRAEAGVALGATRVIYPAGQKQEQLAVTNNDENSTYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAEKLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVME DIP protein P31697 original sequence version: 103 DIP protein P31697 original sequence version: 119 B1AD63C33C8FACB4 fimh_ecoli Type 1 fimbrin D-mannose specific adhesin fimH Protein FimH JW4283 b4320 protein protein ecoli Escherichia coli (strain K12) MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ DIP protein P08191 original sequence version: 96 DIP protein P08191 original sequence version: 112 939204A51658747D fimc-fimh-1 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction , octameric, multimeric, hexadecameric, multimeric working 76.00%, free 73.200% 2.8A