IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phytochrome signalling is mediated through nucleoside diphosphate kinase 2. Phytochrome signalling is mediated through nucleoside diphosphate kinase 2. Nature (0028-0836) 1999 Choi G., Yi H., Lee J., Kwon YK., Soh MS., Shin B., Luka Z., Hahn TR., Song PS. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. gtcoi@ksc.kumho.co.kr A cDNA library from 1 week old light grown arabidopsis seedlings (ecotype Columbia) was used in this yeast two hybrid assay. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Choi G., Yi H., Lee J., Kwon YK., Soh MS., Shin B., Luka Z., Hahn TR., Song PS. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. gtcoi@ksc.kumho.co.kr A cDNA library from 1 week old light grown arabidopsis seedlings (ecotype Columbia) was used in this yeast two hybrid assay. Nature (0028-0836) 1999 Phytochrome signalling is mediated through nucleoside diphosphate kinase 2. Phytochrome signalling is mediated through nucleoside diphosphate kinase 2. Nature (0028-0836) 1999 Choi G., Yi H., Lee J., Kwon YK., Soh MS., Shin B., Luka Z., Hahn TR., Song PS. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. gtcoi@ksc.kumho.co.kr A cDNA library from 1 week old light grown arabidopsis seedlings (ecotype Columbia) was used in this yeast two hybrid assay. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Choi G., Yi H., Lee J., Kwon YK., Soh MS., Shin B., Luka Z., Hahn TR., Song PS. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Directed yeast two hybrid assay. Figure 1 (a, (c) and (d). gtcoi@ksc.kumho.co.kr A cDNA library from 1 week old light grown arabidopsis seedlings (ecotype Columbia) was used in this yeast two hybrid assay. Nature (0028-0836) 1999 ndk2_arath Nucleoside diphosphate kinase II, chloroplastic NDPK2 At5g63310 MDC12.28 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRRLRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE E9EE97A77942E5EA phya_arath Phytochrome A PHYA HY8 At1g09570 F14J9.23 FHY2 FRE1 Protein FAR RED ELONGATED HYPOCOTYL 2 Protein FAR RED ELONGATED 1 Protein ELONGATED HYPOCOTYL 8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFEESGSSFDYSTSVRVTGPVVENQPPRSDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEHPVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRTSAKPFYAIIHRVTGSIIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVMAYKFHEDDHGEVVSEVTKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARVLQDEKLSFDLTLCGSTLRAPHSCHLQYMANMDSIASLVMAVVVNEEDGEGDAPDATTQPQKRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLLCDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTTPSEFHLQEIASWLCEYHMDSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPDDRDDARRMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDSETTDVNTKVIYSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDEAIGKHFLTLVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLVVNACASRDLHENVVGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQNPNPLIPPIFGTDEFGWCTEWNPAMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQDPEKVSFAFFTRGGKYVECLLCVSKKLDREGVVTGVFCFLQLASHELQQALHVQRLAERTAVKRLKALAYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESIIEGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASLRKDQLGRSVHLANLEIRLTHTGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAAANK DIP protein P14712 original sequence version: 133 D8B359713430744B phya-ndpk2 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-626462]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 1193-1193, sequence length 1122 [EBI-626462]568-1193 physical association physical association phya-ndpk2-1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-626489]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 1193-1193, sequence length 1122 [EBI-626489]568-1193 physical association physical association phya-ndpk2-2 2 4 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-626495]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 1193-1193, sequence length 1122 [EBI-626495]656-1193 P14712:p.Gly727Glu Glycine to glutamine at position 788 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Wed May 02 16:14:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly727glu' Tue Jun 30 17:00:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly727Glu' P14712:p.Gly750Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G E Wed May 02 19:21:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly750glu' Tue Jun 30 20:15:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly750Glu' 3 unspecified role unspecified role prey prey physical association physical association