IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Nuclear factor-kappa B potently up-regulates the promoter activity of RANTES, a chemokine that blocks HIV infection. Nuclear factor-kappa B potently up-regulates the promoter activity of RANTES, a chemokine that blocks HIV infection. J. Immunol. (0022-1767) 1997 imex curation Moriuchi H., Moriuchi M., Fauci A.S. IBD - Inflammatory bowel disease When I wanted to assign an Imex ID, I got an error message saying it's not possible to register the publication in IMEx central....I don't know why? All probes are said to correspond to the human CCL5/RANTES promoter, but the kB1, kB2 and NFAT probes do not match when I use blat (the CD28RE probe does, there the causalities are captured); when I look at the promoter sequence there are small differences (mistakes in table 1?), for instance NFAT sequence has 5 consecutive T's and not 4 like as indicated in table 1, which seems to be corrected for in the mutated sequence of this probe...all these 'problematic' probes are entered as interactors with organism 'chemical synthesis'. hmoriuchi@atlas.niaid.nih.gov 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Moriuchi H., Moriuchi M., Fauci A.S. IBD - Inflammatory bowel disease The mutated sequence of the putative NFAT element DNA probe does not correspond to the wild type sequence (i.e. there is an additional base in the mutated sequence, or one is lacking in the wild type sequence) (Table 1), hence the exact positions of the base changes could not be derived. DNA probes corresponding to the NF-kB consensus sequence from the Ig k-chain enhancer region, the NFAT consensus sequence from the IL-2 promoter region, and the CD28 response element from the IL-2 promoter were also used as competitors in this experiment; however, the sequences of these probe could not be established, hence interactions involving these participants are not captured here. When I wanted to assign an Imex ID, I got an error message saying it's not possible to register the publication in IMEx central....I don't know why? All probes are said to correspond to the human CCL5/RANTES promoter, but the kB1, kB2 and NFAT probes do not match when I use blat (the CD28RE probe does, there the causalities are captured); when I look at the promoter sequence there are small differences (mistakes in table 1?), for instance NFAT sequence has 5 consecutive T's and not 4 like as indicated in table 1, which seems to be corrected for in the mutated sequence of this probe...all these 'problematic' probes are entered as interactors with organism 'chemical synthesis'. Nuclear extracts were prepared from cells stimulated with phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) and ionomycin (CHEBI:63954). hmoriuchi@atlas.niaid.nih.gov Accepted 2014-DEC-18 by ORCHARD J. Immunol. (0022-1767) 1997 imex curation ccl5_human_cd28re_dna-probe Human CCL5 gene promoter CD28 response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AAAGCAAGAAATTCCCACAA nfac2_human Nuclear factor of activated T-cells, cytoplasmic 2 T-cell transcription factor NFAT1 NFAT pre-existing subunit NFATC2 NFAT1 NFATP protein protein human Homo sapiens Human MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT DIP protein Q13469 original sequence version: 99 DIP protein Q13469 original sequence version: 100 DIP protein Q13469 original sequence version: 167 8DAE86855CCB58D3 p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 ccl5-derived_putative-nfkb-site1_dna-probe Human CCL5 gene promoter derived putative consensus NF-kappaB-binding site 1 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) ATTTTGGAAACTCCCTTAGG ccl5-derived_putative-nfkb-site2_dna-probe Human CCL5 gene promoter derived putative consensus NF-kappaB-binding site 2 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TTGAGGGGATGCCCCTAAGG ccl5-derived_putative-nfat-site_dna-probe Human CCL5 gene promoter derived putative consensus NFAT-binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV 03E1033BDF7B1B30 ccl5_derived-rela-2 1 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 7b ccl5_derived-ccl5_derived-6 1 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association Fig. 7a ccl5_derived-ccl5_derived-1 1 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 7 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 7a ccl5_derived-nfkb1-2 1 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association Fig. 7b ccl5_derived-ccl5_derived-2 1 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 7a ccl5_derived-nfatc2-1 1 3 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 8b ccl5_derived-nfkb1-1 1 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 8c ccl5_derived-rela-1 1 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association Fig. 8c ccl5_derived-ccl5_derived-3 1 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 8 competitor competitor competitor prey prey region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 8a ccl5_derived-ccl5_derived-4 1 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 competitor competitor competitor prey prey region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 8a ccl5_derived-ccl5_derived-5 1 8 competitor competitor competitor prey prey region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association Fig. 8a ccl5-rela-1 1 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 9b, 10b, 10c treatment with anti-CD3 and anti-CD28 antibodies Q04206 increases expression at RNA level of ENSG00000271503 ccl5-nfkb1-1 1 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association Fig. 9b, 10b, 10c treatment with anti-CD3 and anti-CD28 antibodies ccl5-rel-2 1 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association Fig. 9b, 10b, 10c treatment with anti-CD3 and anti-CD28 antibodies Q04864 increases expression at RNA level of ENSG00000271503 ccl5-ccl5-6 1 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 2 competitor competitor competitor prey prey g8c_a10t_t13g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 9a ccl5-ccl5-1 1 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 2 competitor competitor competitor prey prey g8c_a10t_t13g mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association Fig. 9a ccl5-ccl5-2 1 9 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 2 competitor competitor competitor prey prey g8c_a10t_t13g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 9a ccl5-ccl5_derived-6 1 9 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 9a ccl5-ccl5_derived-1 1 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association Fig. 9a ccl5-ccl5_derived-2 1 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 9a ccl5-ccl5_derived-3 1 7 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 9a ccl5-ccl5_derived-4 1 7 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association Fig. 9a ccl5-ccl5_derived-5 1 2 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells 7 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 9a