IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Nuclear matrix protein SMAR1 control regulatory T-cell fate during inflammatory bowel disease (IBD). Nuclear matrix protein SMAR1 control regulatory T-cell fate during inflammatory bowel disease (IBD). Mucosal immunology 2015 imex curation Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S., Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S. IBD - Inflammatory bowel disease samit@nccs.res.in 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S., Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S. IBD - Inflammatory bowel disease Results obtained using anti-H3 and anti SMAD2/3 antibodies have not been included due to lack of antibody specificity. Wild-type and SMAR1−/− naive CD4+ T cells from the spleen, treated with TGF-beta 1 +/- IL2, +/- stimulation by anti-CD3/28. samit@nccs.res.in Accepted 2015-DEC-01 AT 09:03 GMT AT 09:03 GMT by ORCHARD Mucosal immunology 2015 imex curation Nuclear matrix protein SMAR1 control regulatory T-cell fate during inflammatory bowel disease (IBD). Nuclear matrix protein SMAR1 control regulatory T-cell fate during inflammatory bowel disease (IBD). Mucosal immunology 2015 imex curation Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S., Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S. IBD - Inflammatory bowel disease samit@nccs.res.in 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S., Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S. IBD - Inflammatory bowel disease Results obtained using anti-H3 antibodies have not been included due to lack of antibody specificity. CD4+CD25+ Treg and CD4+CD25− T cells from the spleen, treated with TGF-beta1 and IL-2, with anti-CD3/28. samit@nccs.res.in Accepted 2015-DEC-01 AT 09:03 GMT AT 09:03 GMT by ORCHARD Mucosal immunology 2015 imex curation banp_mouse Protein BANP Btg3-associated nuclear protein Scaffold/matrix-associated region-1-binding protein Banp Smar1 protein protein mouse Mus musculus Mouse MMSEQDLADVVQIAVEDLSPDHPVVLENHVVTDDDEPALKRQRLEINCQDPSIKSFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTVILNNDRQNAIVAKMEDPLSNRAPDSLENIISNAVPGRRQNTIVVKVPGQDDSHNEDGESGSEASDSVSNCGQPGSQNIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPSSSSYSASETMMGTPPPTSELQQSQPQALHYALANAQQVQIHQIGEDGQVQVIPQGHLHIAQVPQGEQVQITQDSEGNLQIHHVGQDGQSWGLCQNPIPVSGDSVAQANPSQLWPLGGDTLDLPAGNEMIQVLQGAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSDHTAAAQTAEALQPTLQPDMQLEHGAIQIQ 9C48D5E122ECB2D1 hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P42227 original sequence version: 169 DIP protein P42227 original sequence version: 162 DIP protein P42227 original sequence version: 164 DIP protein P42227 original sequence version: 141 6C00626711C8012D foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse stat3_mouse_gene Signal transducer and activator of transcription 3 Stat3 Aprf gene gene mouse Mus musculus Mouse stat3-foxp3-2 1 6 unspecified role unspecified role prey prey promoter_region_(cns2) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait tyr705 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm association association 8C P08505 increases the binding of P42227 to ENSMUSG00000039521 It is stated earlier in this publication that:- "STAT3......binds to the CNS2 region (silencer site) of Foxp3 promoter and represses its transcription", thus it has been assumed primers for the CNS2 site have been used here; the CNS2 site is usually referred to as an "enhancer", located in intron-1, not as part of the (upstream) promoter. Is is stated that:- "cells treated with TGF-beta-1 ..... resulted in less binding of STAT3 to the Foxp3 promoter in WT CD4+ T cells (Figure 8c)";however no results are shown for cells not treated with TGF-beta-1 to verify this statement. Q8VBU8 decreases the binding of P42227 to ENSMUSG00000039521 Q8VBU8 increases the expression at protein level of ENSMUSG00000039521 Q8VBU8 increases the expression at RNA level of ENSMUSG00000039521 banp-stat3-1 1 7 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association 8 D/F P04351 and P04202 increased the binding of Q8VBU8 to ENSMUSG00000004040 Q8VBU8 increases the expression at RNA level of ENSMUSG00000004040 Q8VBU8 increases the expression at protein level of ENSMUSG00000004040 IL-2 (P04351) TGF-beta1 (P042020) hdac1-stat3-1 1 7 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association 8 D/F P04351 and P04202 increased the binding of O09106 to ENSMUSG00000004040 TGF-beta1 (P042020) IL-2 (P04351) banp-stat3-2 2 7 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association 8 G Binding of SMAR1 to the STAT3 promoter in CD4+CD25+ Treg cells is greater than in CD4+CD25− T cells. P04351 increases the expression at protein level of Q8VBU8 causality from Supp 3B hdac1-stat3-2 2 7 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association 8 Gi Binding of HDAC1 to the STAT3 promoter in CD4+CD25+ Treg cells is greater than in CD4+CD25− T cells.