IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ KLF2 is a rate-limiting transcription factor that can be targeted to enhance regulatory T-cell production. KLF2 is a rate-limiting transcription factor that can be targeted to enhance regulatory T-cell production. Proceedings of the National Academy of Sciences of the United States of America 2014 imex curation Pabbisetty SK., Rabacal W., Maseda D., Cendron D., Collins PL., Hoek KL., Parekh VV., Aune TM., Sebzda E. IBD - Inflammatory bowel disease eric.sebzda@vanderbilt.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Pabbisetty SK., Rabacal W., Maseda D., Cendron D., Collins PL., Hoek KL., Parekh VV., Aune TM., Sebzda E. IBD - Inflammatory bowel disease CD4+CD25− T cells that were TCR-stimulated in the presence (iTregs) or absence (mock control) of TGF-beta. eric.sebzda@vanderbilt.edu Accepted 2016-FEB-11 AT 10:28 GMT AT 10:28 GMT by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62806 original sequence version: 108 A9E5DFD3F8B97598 klf2_mouse Krueppel-like factor 2 Klf2 Lklf Lung krueppel-like factor protein protein mouse Mus musculus Mouse MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSMGLDGLGAENPPEPPPQPPPPAFYYPEPGAPPPYSIPAASLGTELLRPDLDPPQGPALHGRFLLAPPGRLVKAEPPEVDGGGYGCAPGLAHGPRGLKLEGAPGATGACMRGPAGRPPPPPDTPPLSPDGPLRIPASGPRNPFPPPFGPGPSFGGPGPALHYGPPAPGAFGLFEDAAAAAAALGLAPPATRGLLTPPSSPLELLEAKPKRGRRSWPRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHCNWEGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM 31A99C00DFC5B810 foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse klf2-foxp3-1 1 4 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cns1_cns2_cns3_enhancer_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association 4A TGF-beta CHEBI:9150 increases expression at protein level of Q60843. CHEBI:9150 increases expression at RNA level of Q60843. CHEBI:65329 increases expression at protein level of Q60843. CHEBI:77954 increases expression at protein level of Q60843. CHEBI:9168 increases expression at protein level of Q60843. klf2-foxp3-2 1 4 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cns1_cns2_cns3_enhancer_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4B TGF-beta Q60843 is required for the binding of P62806 to ENSMUSG00000039521