IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. Mol. Carcinog. (0899-1987) 2013 imex curation Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Figure 2 A/C refers to Pin1 and COT as having 166 and 468 residues, respectively; however, UniProt and NCBI identifiers for the longest isoforms refer to human proteins with 163 and 467 amino acids, respectively, as do all historic UniProt sequences. No other species (in Uniprot) would appear to have 166 residues for Pin1 or 468 residues for COT. Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Accepted 2014-DEC-17 by MGT Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. Mol. Carcinog. (0899-1987) 2013 imex curation Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Accepted 2014-DEC-17 by MGT Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. Mol. Carcinog. (0899-1987) 2013 imex curation Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Accepted 2014-DEC-17 by MGT Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. Mol. Carcinog. (0899-1987) 2013 imex curation Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Accepted 2014-DEC-17 by MGT Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. Mol. Carcinog. (0899-1987) 2013 imex curation Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Accepted 2014-DEC-17 by MGT Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. COT phosphorylates prolyl-isomerase Pin1 to promote tumorigenesis in breast cancer. Mol. Carcinog. (0899-1987) 2013 imex curation Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kim G., Khanal P., Kim J.Y., Yun H.J., Lim S.C., Shim J.H., Choi H.S. IBD - Inflammatory bowel disease Information about wildtype and mutant COT expression constructs was derived from PMID:10072079. Information about PIN1 cDNA cloned in different vectors was derived from PMID:8606777. Information about recombinant active human COT and human Pin1 was obtained from the supplier's website (R&D Systems). chs@chosun.ac.kr Accepted 2014-DEC-17 by MGT Mol. Carcinog. (0899-1987) 2013 Only protein-protein interactions imex curation pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 m3k8_human Mitogen-activated protein kinase kinase kinase 8 MAP3K8 COT ESTF Serine/threonine-protein kinase cot Cancer Osaka thyroid oncogene Tumor progression locus 2 Proto-oncogene c-Cot protein protein human Homo sapiens Human MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG 7728969EA3E4E8EC pin1-map3k8 4 8 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P41279:p.Ser413Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:10:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser413ala' Tue Jun 30 17:04:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser413Ala' P41279:p.Ser400Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:37:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser400ala' Tue Jun 30 17:03:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser400Ala' 7 unspecified role unspecified role bait bait n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1b, 2f map3k8-pin1 4 8 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P41279:p.Ser400Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:25:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser400ala' Tue Jun 30 20:26:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser400Ala' P41279:p.Ser413Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:15:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser413ala' Tue Jun 30 19:54:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser413Ala' 7 unspecified role unspecified role prey prey n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1c, 2e map3k8-pin1-1 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1d 12-O-Tetradecanoylphorbol 13-acetate (TPA) (CHEBI:37537) According to the text this interaction involves Myc-tagged COT and Xpress-tagged Pin1, which were both transfected in MCF7 cells; however, from the figure legend it appears that binding of endogenous Pin1 to Myc-tagged COT was investigated. map3k8-pin1-2 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 1e 12-O-Tetradecanoylphorbol 13-acetate (TPA) (CHEBI:37537) pin1-map3k8-1 2 7 acceptor acceptor bait bait 8 acceptor acceptor prey prey physical association physical association Fig. 1a pin1-map3k8-2 1 7 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ww_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 2b map3k8-pin1-3 1 7 unspecified role unspecified role prey prey n-terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2d map3k8-pin1-5 6 7 enzyme target enzyme target substrate substrate neutral component neutral component region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range prot_kinase_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Q13526 ser-16 O-phospho-L-serine Q13526 phosphorylation Fig. 3a P41279 is required for phosphorylation of Q13526 CHEBI:37537 increases binding of P41279 to Q13526 In vivo protein kinase assays using anti-phosphoserine-16 Pin1 antibody indicated that COT phosphorylates Pin1 at serine-16. map3k8-1 6 8 putative self putative self putative self putative self n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range prot_kinase_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation true Fig. 3a P41279 is required for phosphorylation of P41279 P41279 phosres