IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease MCF-7 cells were stably transfected with control vector or vector expressing MUC1-C. donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease MCF-7 cells were stably transfected with control vector or vector expressing MUC1-C. donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. MUC1-C oncoprotein activates ERK→C/EBPβ signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells. J. Biol. Chem. (0021-9258) 2013 imex curation Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease donald_kufe@dfci.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Alam M., Ahmad R., Rajabi H., Kharbanda A., Kufe D. IBD - Inflammatory bowel disease MDA-MB-468 cells were infected with a lentiviral vector expressing a scrambled or MUC1 shRNA. donald_kufe@dfci.harvard.edu Accepted 2015-FEB-02 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation p17676-2 CCAAT/enhancer-binding protein beta C/EBPbeta-LAP CEBPB TCF5 Liver activator protein Liver-enriched inhibitory protein Nuclear factor NF-IL6 Transcription factor 5 PP9092 protein protein human Homo sapiens Human MEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC 842B381C36DFA8CE al1a1_human_gene Retinal dehydrogenase 1 (ALDH1A1) human gene gene gene human Homo sapiens Human cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D p15941-pro_0000317447 Mucin-1 subunit beta MUC1 PUM Breast carcinoma-associated antigen DF3 Cancer antigen 15-3 Carcinoma-associated mucin Episialin H23AG Krebs von den Lungen-6 PEMT Peanut-reactive urinary mucin Polymorphic epithelial mucin Tumor-associated epithelial membrane antigen Tumor-associated mucin protein protein human Homo sapiens Human SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL 1098 1255 A48A62BE6B7AE661 cebpb-muc1 7 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 3a, 3b muc1-cebpb 7 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey possible phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3a cebpb-muc1-1 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 3d muc1-cebpb-1 4 12 unspecified role unspecified role prey prey possible phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait physical association physical association Fig. 3d cebpb-muc1-2 5 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component possible phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3c cebpb-muc1-3 2 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component possible phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3e cebpb-muc1-4 6 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig. 3f muc1-cebpb-2 6 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey possible phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3f cebpb-muc1-5 3 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P17676-2:p.Cys12Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:58:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys12ala' Tue Jun 30 19:15:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys12Ala' ecolx Escherichia coli 13 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P15941-PRO_0000317447:p.[Cys87Ala;Cys89Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:45:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys87ala,cys89ala' Tue Jun 30 15:43:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys87Ala;Cys89Ala]' ecolx Escherichia coli direct interaction direct interaction Fig. 4b, 4d, 4e, 4f cebpb-al1a1 9 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6a anti-MUC1 shRNA P15941-PRO_0000317447 increases binding of P17676 to ENSG00000165092 muc1-al1a1 9 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 6b anti-MUC1 shRNA This interaction was determined by re-ChIP with anti-MUC1-C antibody after an initial ChIP with anti-C/EBP-beta antibody. P15941-PRO_0000317447 increases expression at RNA level of ENSG00000165092 P15941-PRO_0000317447 increases expression at protein level of ENSG00000165092 muc1-al1a1-1 8 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 6d anti-MUC1 shRNA This interaction was determined by re-ChIP with anti-MUC1-C antibody after an initial ChIP with anti-C/EBP-beta antibody. P15941-PRO_0000317447 increases expression at RNA level of ENSG00000165092 P15941-PRO_0000317447 increases expression at protein level of ENSG00000165092 cebpb-al1a1-1 8 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6c anti-MUC1 shRNA P15941-PRO_0000317447 increases binding of P17676 to ENSG00000165092 cebpb-al1a1-2 1 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait association association Fig. 6e MUC1-C overexpression P17676 increases expression at RNA level of ENSG00000165092 P17676 increases expression at protein level of ENSG00000165092 P15941-PRO_0000317447 increases binding of P17676 to ENSG00000165092 muc1-al1a1-2 1 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association Fig. 6f MUC1-C overexpression This interaction was determined by re-ChIP with anti-MUC1-C antibody after an initial ChIP with anti-C/EBP-beta antibody. P15941-PRO_0000317447 increases expression at RNA level of ENSG00000165092 P15941-PRO_0000317447 increases expression at protein level of ENSG00000165092