IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) FLAG-KAP1 has been entered as being of Human origin, based on the fact quoted Refs 16,17 refer to the Human protein. sziegler@benaroyaresearch.org Accepted 2017-JAN-26 AT 17:19 GMT AT 17:19 GMT by PPORRAS Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease Results from anti-H3 assays have not been included due to lack of H3 antibody specificity. email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) TRegs;CD4+CD25+ cells sziegler@benaroyaresearch.org Accepted 2017-JAN-26 AT 17:19 GMT AT 17:19 GMT by PPORRAS Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org Accepted 2017-JAN-26 AT 17:19 GMT AT 17:19 GMT by PPORRAS Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast lexa b52 complement lexa b52 complementation LexA B52 transcription complementation lexa b52 complement nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org Accepted 2017-JAN-26 AT 17:19 GMT AT 17:19 GMT by PPORRAS human Treg cells (CD4+CD25+) cDNA Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease The anti-DBD antibody has been assumed to be to the GAL4-DBD from previous work by the first author - see ref 9. email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org Accepted 2017-JAN-26 AT 17:19 GMT AT 17:19 GMT by PPORRAS Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) sziegler@benaroyaresearch.org 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF., Huang C., Martin S., Pfleger C., Du J., Buckner JH., Bluestone JA., Riley JL., Ziegler SF. IBD - Inflammatory bowel disease email was sent to confirm(?) species of FLAG-KAP1 - in IPs - Data Proc comment written saying it is human - ref 16/7 (no reply to email) TReg cells;CD4+CD25+ sziegler@benaroyaresearch.org Accepted 2017-JAN-26 AT 17:19 GMT AT 17:19 GMT by PPORRAS Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 q8tf47-3 Zinc finger protein 90 homolog ZFP90 KIAA1954 ZNF756 Zinc finger protein 756 FIK FOXP3-interacting KRAB-domain containing protein protein protein human Homo sapiens Human MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKPEVIFKLEQGEEPWISEGEIQRPFYPGFVCLLPLSLPSGSKGERRQKLPRKNPE Interacts (via 75-113 AA) with FOXP3. Interacts (via KRAB domain) with TRIM28. 61D16304A863D683 tif1b_human Transcription intermediary factor 1-beta TRIM28 KAP1 RNF96 TIF1B Tripartite motif-containing protein 28 Nuclear corepressor KAP-1 KRAB-associated protein 1 KRAB-interacting protein 1 RING finger protein 96 E3 SUMO-protein ligase TRIM28 RING-type E3 ubiquitin transferase TIF1-beta protein protein human Homo sapiens Human MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGTPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP DIP protein Q13263 original sequence version: 156 DIP protein Q13263 original sequence version: 154 DIP protein Q13263-1 original sequence version: 143 DIP protein Q13263 original sequence version: 198 DIP protein Q13263 original sequence version: 155 2027BABB7C94FE20 foxp3_human Forkhead box protein P3 Scurfin FOXP3 IPEX JM2 protein protein human Homo sapiens Human MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP DIP protein Q9BZS1 original sequence version: 139 DIP protein Q9BZS1 original sequence version: 131 91737C3CEA665A15 il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human ifng_human_gene Interferon gamma IFNG gene gene human Homo sapiens Human 3215r3wqr-1 4 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association S1A 4wre-1 6 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1B foxp3-zfp90-1 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role ancillary ancillary region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2A FOXP3 could be only be coimmunoprecipitated in the presence of FIK. foxp3-il2_human_gene-4 2 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2C trim28-il2_human_gene-1 2 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2Ci Q13263 decreased the expression at protein level of ENSG00000109471 zfp90-il2_human_gene-1 2 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2Cii zfp90-il2_human_gene-2 3 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2D foxp3-il2_human_gene-5 3 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2D Q13263 decreased the expression at RNA level of ENSG00000111537 Q9BZS1 decreased the expression at RNA level of ENSG00000111537 trim28-il2_human_gene-2 3 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2D hist1h4a-il2_human_gene-1 2 7 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm 11 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4C Q9BZS1 decreased the binding of P62805 to ENSG00000109471 Q13263 decreased the binding of P62805 to ENSG00000109471 caus. from fig 4 Q9BZS1 decreased the expression at RNA level of ENSG00000109471 Q13263 decreased the expression at RNA level of ENSG00000109471 zfp90-foxp3-1 5 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 1B zfp90-foxp3-2 5 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey unique_c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 1C foxp3-zfp90-2 5 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait krab_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 2B