IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma. SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma. Blood (0006-4971) 2013 imex curation Higuchi T., Nakayama T., Arao T., Nishio K., Yoshie O. IBD - Inflammatory bowel disease I'm not sure about the ChIP in activated CD4+ cells (Fig. 2E, second panel); they don't mention binding of JunD to SOX4 promoter in the text in these cells (actually they say interaction is only observed in ATL cell lines (HUT102 and ST1); however, their statistics show there is significant enrichment of SOX4 promoter DNA compared to IgG control...so I captured it for now... Activated CD4+ T cells were prepared by culturing normal resting CD4+ T cells in the presence of Dynabeads Human T-Activator CD3/CD28 (Life Technologies) and 100 U/mL recombinant IL-2 (Shionogi) for 12 days. Expression constructs of human c-Fos, Fra-2 and JunD are described in PMID:18071306 and PMID:11145887. o.yoshie@med.kindai.ac.jp 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Higuchi T., Nakayama T., Arao T., Nishio K., Yoshie O. IBD - Inflammatory bowel disease I'm not sure about the ChIP in activated CD4+ cells (Fig. 2E, second panel); they don't mention binding of JunD to SOX4 promoter in the text in these cells (actually they say interaction is only observed in ATL cell lines (HUT102 and ST1); however, their statistics show there is significant enrichment of SOX4 promoter DNA compared to IgG control...so I captured it for now... Activated CD4+ T cells were prepared by culturing normal resting CD4+ T cells in the presence of Dynabeads Human T-Activator CD3/CD28 (Life Technologies) and 100 U/mL recombinant IL-2 (Shionogi) for 12 days. Expression constructs of human c-Fos, Fra-2 and JunD are described in PMID:18071306 and PMID:11145887. o.yoshie@med.kindai.ac.jp Accepted 2015-JAN-05 by ORCHARD Blood (0006-4971) 2013 Only protein-protein interactions imex curation SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma. SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma. Blood (0006-4971) 2013 imex curation Higuchi T., Nakayama T., Arao T., Nishio K., Yoshie O. IBD - Inflammatory bowel disease I'm not sure about the ChIP in activated CD4+ cells (Fig. 2E, second panel); they don't mention binding of JunD to SOX4 promoter in the text in these cells (actually they say interaction is only observed in ATL cell lines (HUT102 and ST1); however, their statistics show there is significant enrichment of SOX4 promoter DNA compared to IgG control...so I captured it for now... Activated CD4+ T cells were prepared by culturing normal resting CD4+ T cells in the presence of Dynabeads Human T-Activator CD3/CD28 (Life Technologies) and 100 U/mL recombinant IL-2 (Shionogi) for 12 days. Expression constructs of human c-Fos, Fra-2 and JunD are described in PMID:18071306 and PMID:11145887. o.yoshie@med.kindai.ac.jp 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Higuchi T., Nakayama T., Arao T., Nishio K., Yoshie O. IBD - Inflammatory bowel disease I'm not sure about the ChIP in activated CD4+ cells (Fig. 2E, second panel); they don't mention binding of JunD to SOX4 promoter in the text in these cells (actually they say interaction is only observed in ATL cell lines (HUT102 and ST1); however, their statistics show there is significant enrichment of SOX4 promoter DNA compared to IgG control...so I captured it for now... Activated CD4+ T cells were prepared by culturing normal resting CD4+ T cells in the presence of Dynabeads Human T-Activator CD3/CD28 (Life Technologies) and 100 U/mL recombinant IL-2 (Shionogi) for 12 days. Expression constructs of human c-Fos, Fra-2 and JunD are described in PMID:18071306 and PMID:11145887. o.yoshie@med.kindai.ac.jp Accepted 2015-JAN-05 by ORCHARD Blood (0006-4971) 2013 Only protein-protein interactions imex curation SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma. SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma. Blood (0006-4971) 2013 imex curation Higuchi T., Nakayama T., Arao T., Nishio K., Yoshie O. IBD - Inflammatory bowel disease I'm not sure about the ChIP in activated CD4+ cells (Fig. 2E, second panel); they don't mention binding of JunD to SOX4 promoter in the text in these cells (actually they say interaction is only observed in ATL cell lines (HUT102 and ST1); however, their statistics show there is significant enrichment of SOX4 promoter DNA compared to IgG control...so I captured it for now... Activated CD4+ T cells were prepared by culturing normal resting CD4+ T cells in the presence of Dynabeads Human T-Activator CD3/CD28 (Life Technologies) and 100 U/mL recombinant IL-2 (Shionogi) for 12 days. Expression constructs of human c-Fos, Fra-2 and JunD are described in PMID:18071306 and PMID:11145887. o.yoshie@med.kindai.ac.jp 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Higuchi T., Nakayama T., Arao T., Nishio K., Yoshie O. IBD - Inflammatory bowel disease I'm not sure about the ChIP in activated CD4+ cells (Fig. 2E, second panel); they don't mention binding of JunD to SOX4 promoter in the text in these cells (actually they say interaction is only observed in ATL cell lines (HUT102 and ST1); however, their statistics show there is significant enrichment of SOX4 promoter DNA compared to IgG control...so I captured it for now... Activated CD4+ T cells were prepared by culturing normal resting CD4+ T cells in the presence of Dynabeads Human T-Activator CD3/CD28 (Life Technologies) and 100 U/mL recombinant IL-2 (Shionogi) for 12 days. Expression constructs of human c-Fos, Fra-2 and JunD are described in PMID:18071306 and PMID:11145887. o.yoshie@med.kindai.ac.jp Accepted 2015-JAN-05 by ORCHARD Blood (0006-4971) 2013 Only protein-protein interactions imex curation fosl2_human Fos-related antigen 2 FOSL2 FRA2 protein protein human Homo sapiens Human MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL DIP protein P15408 original sequence version: 99 DIP protein P15408 original sequence version: 123 sox4_human_gene Transcription factor SOX-4 (SOX4) human gene gene gene human Homo sapiens Human jund_human Transcription factor jun-D JUND protein protein human Homo sapiens Human METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY DIP protein P17535 original sequence version: 147 DIP protein P17535 original sequence version: 119 FE85A1AA2B5B9597 sox4-jund-3 3 5 unspecified role unspecified role bait bait promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Fig. 2e This interaction occurred in activated CD4+ T cells but not in normal resting CD4+ T cells. sox4-fosl2-2 2 5 unspecified role unspecified role bait bait promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey association association Fig. 2e P15408 increases expression at RNA level of ENSG00000124766 sox4-jund-1 2 5 unspecified role unspecified role bait bait promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Fig. 2e P17535 increases expression at RNA level of ENSG00000124766 sox4-jund-2 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2e sox4-fosl2-1 1 5 unspecified role unspecified role bait bait promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey association association Fig. 2e