IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TNF-α impairs differentiation and function of TGF-β-induced Treg cells in autoimmune diseases through Akt and Smad3 signaling pathway. TNF-α impairs differentiation and function of TGF-β-induced Treg cells in autoimmune diseases through Akt and Smad3 signaling pathway. Journal of molecular cell biology 2013 imex curation Zhang Q., Cui F., Fang L., Hong J., Zheng B., Zhang JZ. IBD - Inflammatory bowel disease Results from figure 6G have not been included due to the use of a non-specific "AKT" antibody, and the origin of the "AA" mutant are not stated. jingwu.z.zang@gsk.com 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zhang Q., Cui F., Fang L., Hong J., Zheng B., Zhang JZ. IBD - Inflammatory bowel disease Results from figure 6G have not been included due to the use of a non-specific "AKT" antibody, and the origin of the "AA" mutant are not stated. there is an annotation I cannot remove "P06804 decreases at RNA level the expression of ENSMUSG00000039521" - I added "indirectly " to this , but cannot get rid of the original; editor needs restarting, but Max is off for another 2/3 days;Please can we all learn to restart the editor!! (or some of us at any rate...) nuclear extracts from CD4+ T cells 24 h after iTreg induction jingwu.z.zang@gsk.com Accepted 2015-OCT-12 AT 09:37 BST AT 09:37 BST by ORCHARD Journal of molecular cell biology 2013 Only protein-protein interactions imex curation imex curation TNF-α impairs differentiation and function of TGF-β-induced Treg cells in autoimmune diseases through Akt and Smad3 signaling pathway. TNF-α impairs differentiation and function of TGF-β-induced Treg cells in autoimmune diseases through Akt and Smad3 signaling pathway. Journal of molecular cell biology 2013 imex curation Zhang Q., Cui F., Fang L., Hong J., Zheng B., Zhang JZ. IBD - Inflammatory bowel disease Results from figure 6G have not been included due to the use of a non-specific "AKT" antibody, and the origin of the "AA" mutant are not stated. jingwu.z.zang@gsk.com 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Zhang Q., Cui F., Fang L., Hong J., Zheng B., Zhang JZ. IBD - Inflammatory bowel disease Results from figure 6G have not been included due to the use of a non-specific "AKT" antibody, and the origin of the "AA" mutant are not stated. primary CD4+ T cells 48 h after iTreg induction. jingwu.z.zang@gsk.com Accepted 2015-OCT-12 AT 09:37 BST AT 09:37 BST by ORCHARD Journal of molecular cell biology 2013 Only protein-protein interactions imex curation imex curation smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein Q8BUN5 original sequence version: 57 46DF5E8B371321AC foxp3_promoter_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GAAGAGCGAGGTCTGCGGCTTCCACGCCG foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse nfac1_mouse Nuclear factor of activated T-cells, cytoplasmic 1 Nfatc1 Nfat2 Nfatc NFAT transcription complex cytosolic component protein protein mouse Mus musculus Mouse MPNTSFPVPSKFPLGPPAAVCGSGETLRPAPPSGGTMKAAEEEHYSYVSPSVTSTLPLPTAHSALPAACHDLQTSTPGISAVPSANHPPSYGGAVDSGPSGYFLSSGNTRPNGAPTLESPRIEITSYLGLHHGSGQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSPSTSPRASITEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTEDTWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLGTTPPTSDFPPEEYTFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEIILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPAQVSFYVCNGKRKRSQYQRFTYLPANGNSVFLTLSSESELRGGFY mint Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells 58837C6CC085268D foxp3_promoter_probe-smad3-1 2 4 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ser423,ser425 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes physical association physical association 5H smad3-foxp3-4 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5J P06804 (TNF-alpha) P06804 decreases binding of Q8BUN5 to ENSMUSG00000039521 CHEBI:65329 indirectly increases at the protein level the expression of ENSMUSG00000039521 P06804 increases the phosphorylation of P31750 P06804 decreases the phosphorylation of Q8BUN5 CHEBI:65329 indirectly increases the phosphorylation of Q8BUN5 CHEBI:65329 indirectly inhibits the phosphorylation of P31750 CHEBI:65329 decreases the inhibition of expression at protein level of ENSMUSG00000039521 by P06804 caus. statements from Supp fig 12, fig 6,5 I dont know if we can add the "phosph" derived/including statements - as these are not deduced from "direct" interactions -especially the AKT1 containing statements - P31750. P06804 indirectly decreases at RNA level the expression of ENSMUSG00000039521 foxp3_promoter_probe-smad3-2 2 6 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes 4 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp 14