MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. EMBO Rep. (1469-221X) 2012 imex curation Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. EMBO Rep. (1469-221X) 2012 imex curation Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. EMBO Rep. (1469-221X) 2012 imex curation Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions baker's yeast-mav203 Saccharomyces cerevisiae mav203 Saccharomyces cerevisiae 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease More details on how this experiment was performed are described in PMID:21572392. hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn human adult brain EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. EMBO Rep. (1469-221X) 2012 imex curation Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease More details on how this experiment was performed are described in PMID:21572392. hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. EMBO Rep. (1469-221X) 2012 imex curation Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation. EMBO Rep. (1469-221X) 2012 imex curation Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang Y., Nie J., Wang Y., Zhang L., Lu K., Xing G., Xie P., He F., Zhang L. IBD - Inflammatory bowel disease hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation psb6_mouse Proteasome subunit beta type-6 Proteasome delta chain Macropain delta chain Multicatalytic endopeptidase complex delta chain Proteasome subunit Y Psmb6 Lmp19 Low molecular mass protein 19 protein protein mouse Mus musculus Mouse MAAALAVRRAGSAPAFGPEALTPDWENREVSTGTTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP 5A4EB82C4374C6FE prs4_mouse 26S proteasome regulatory subunit 4 Psmc1 26S proteasome AAA-ATPase subunit RPT2 Proteasome 26S subunit ATPase 1 protein protein mouse Mus musculus Mouse MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL ACA80782F4F96F49 prs6b_mouse 26S proteasome regulatory subunit 6B Proteasome 26S subunit ATPase 4 MB67-interacting protein MIP224 Tat-binding protein 7 CIP21 Psmc4 Tbp7 26S proteasome AAA-ATPase subunit RPT3 protein protein mouse Mus musculus Mouse MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK 6FD2C1E3EB1FF5F0 smuf1_human E3 ubiquitin-protein ligase SMURF1 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 SMURF1 KIAA1625 HECT-type E3 ubiquitin transferase SMURF1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE 89A171CFC47B40E9 prs8_mouse 26S proteasome regulatory subunit 8 Psmc5 Sug1 Proteasome 26S subunit ATPase 5 Proteasome subunit p45 p45/SUG 26S proteasome AAA-ATPase subunit RPT6 protein protein mouse Mus musculus Mouse MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK DIP protein P62196 original sequence version: 79 29C6410C4A85A7F7 psa5_mouse Proteasome subunit alpha type-5 Proteasome zeta chain Macropain zeta chain Multicatalytic endopeptidase complex zeta chain Psma5 protein protein mouse Mus musculus Mouse MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI 5610CDA00469120A pkho1_human Pleckstrin homology domain-containing family O member 1 HQ0024c PLEKHO1 CKIP1 Casein kinase 2-interacting protein 1 Osteoclast maturation-associated gene 120 protein C-Jun-binding protein OC120 protein protein human Homo sapiens Human MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM 5077D6B559EB9F78 psme4_mouse Proteasome activator complex subunit 4 Psme4 Kiaa0077 Proteasome activator PA200 Protein TEMO protein protein mouse Mus musculus Mouse MEAPERAGGGEPPEPGGRPVLGPRAFVPQKEIVYNKLLPYAERLDAESDLQLAQIKSNLGRAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLKKKELLSRDDLELPWRPLYDLVERILYSKTEHLRLNSFPNSIENVLKTLVKSCRPYFPADSTAEMLEEWRPLMCPFDVTMQKAISYFEIFLPTSLPPELHHKGFKLWFDELIGLWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQVLVPRFLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWLNKLMKLLQRLPNSVVRRLHRERFKKPSWLTPVPESHKLTDEDVTDFVQCIIQPVLLAMFSKTGSLEAAQALQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLNCVIGVARSLVSGSKWFPEGPTHMLPLLMRALPGVDPNDFSKCMITFQFIGTFSTLVPLVDCSSVLQERNDLTEIEKELCSATAEFEDFVLQFMDRCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKDIFMVALQKVFNFSVSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCYGVITQLTMNDDVLNEEELDKELLWNLQLLSEITRVDGKKLLLYREQLVKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFNKPPSEYFPVKDWGKPGDLWNLGIQWHVPSSEEVSFAFYLLDSFLQPELIKLQCCGDGELEMSRDDILQSLTIVHSCLIGSGNLLPPLKGEAVTNLVPSMVSLEETKLYTGLEHDLSRENYREVIASVIRKLLSHILDNSEDDTKSLFLIIKIIGDLLHFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEYKKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRKDVTQQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPALVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCAAIAELLQQSKNPSISQTLLSPEKIKEGQKRQQDKNADALRNYECLVNTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFVENLNHDAIVVRKMAISAVAGILKQLKRTHKKLTINPYEISGCPKPTKILAGDRPDNHWLHYDSKNIPRTKKEWESSCFVEKTHWGYYNWPKNMVVYAGVEEQPKLGRSREDMIEAEQIIYDRFSDPKFVEQLITFLSLEDRKGRDKFSPRRFCLFKGIFRNFDDAFLPVLKPHLERLVADSHESTQRCVAEIIAGLIRGSKHWTFEKVEKLWELLCPLLRTALSNMTVETYNDWGTCIATSCESRDPRKLHWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKNVRERIGSVLTYIFMIDVSLPNTAPTTSPCIPEFTARVLEKLKPLTDVDEEIQNHVMEENGIGEEDERTQGIKLLKTILKWLMASAGRSFSTAVKEQLQLLPLFFKIAPVENDNSYDELKRDAKLCLSLMSQGLLYPQQVPLILQVLSQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLIICLLEDEQLEVREMAATTLSGLLQCNFLTMDSAMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA 326FD7B3A070C502 prs7_mouse 26S proteasome regulatory subunit 7 Proteasome 26S subunit ATPase 2 Protein MSS1 Psmc2 Mss1 26S proteasome AAA-ATPase subunit RPT1 protein protein mouse Mus musculus Mouse MPDYLGADQRKTKEEEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN 302E4FA62A48104C prs8_human 26S proteasome regulatory subunit 8 PSMC5 SUG1 Proteasome 26S subunit ATPase 5 Proteasome subunit p45 p45/SUG Thyroid hormone receptor-interacting protein 1 26S proteasome AAA-ATPase subunit RPT6 protein protein human Homo sapiens Human MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 29C6410C4A85A7F7 29C6410C4A85A7F7 psmd8_mouse 26S proteasome non-ATPase regulatory subunit 8 26S proteasome regulatory subunit S14 Psmd8 26S proteasome regulatory subunit RPN12 protein protein mouse Mus musculus Mouse MFIKGRAAKTPRGEPRRSSRGGRKLAVVAPPPVLGSTSRPHFRRESIARRRCRKSGRRLAASRKMAATAATVNGSTTVSSSGPAATSVGILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV 45C8836045CDDDF6 psmd4_mouse 26S proteasome non-ATPase regulatory subunit 4 26S proteasome regulatory subunit S5A 26S proteasome regulatory subunit RPN10 Multiubiquitin chain-binding protein Psmd4 Mcb1 protein protein mouse Mus musculus Mouse MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEDSDDALLKMTINQQEFGRPGLPDLSSMTEEEQIAYAMQMSLQGTEFSQESADMDASSAMDTSDPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQATKDGKNDKKEEEKK 732AC02B56760EAA q9hce7-2 E3 ubiquitin-protein ligase SMURF1 HECT-type E3 ubiquitin transferase SMURF1 SMURF1 KIAA1625 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE F106E00CA3C210AA plekho1-psmc5 3 CKIP1 13 predetermined predetermined participant predetermined nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RPT6 16 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a homomint mint plekho1-psma5 2 Proteasome subunit alpha type-5 12 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 26S proteasome regulatory subunit 8 17 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 26S protease regulatory subunit 7 15 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 26S protease regulatory subunit 6B 9 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 26S protease regulatory subunit 4 8 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Proteasome subunit beta type-6 7 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 26S protease regulatory subunit 8 11 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Proteasome activator complex subunit 4 14 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CKIP1 13 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait living cell living cell 26S proteasome non-ATPase regulatory subunit 4 18 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association st1 mint plekho1-psmc5-1 6 RPT6 16 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli CKIP1 13 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction homomint mint f1b f1c f3a f3b P62195 and Q53GL0 increases degradation at protein level of Q9HCE7 P62195 and Q53GL0 increases degradation at protein level of Q99717 Q53GL0 increases binding of P62195 to Q9HCE7 plekho1-smurf1-1 6 CKIP1 13 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli SMURF1 10 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction homomint mint f3d f2a plekho1-psmc5-2 6 CKIP1 13 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RPT6 16 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3f homomint mint psmc5-plekho1-1 1 RPT6 16 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CKIP1 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1e homomint mint plekho1-psmc5-3 1 CKIP1 13 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RPT6 16 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint f1f f1g plekho1-psmc5-4 4 RPT6 16 anti tag immunost anti tag immunostaining anti tag immunost anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CKIP1 13 anti tag immunost anti tag immunostaining anti tag immunost anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint f1h plekho1-psmc5-5 5 CKIP1 13 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain RPT6 16 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c homomint mint psmc5-plekho1-2 5 CKIP1 13 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RPT6 16 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f3g homomint mint smurf1-plekho1 5 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:38:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys699ala' Tue Jun 30 17:15:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys699Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2b smurf1-psmc5 1 10 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Fig. 2c This interaction was severely reduced in cells transfected with CKIP-1/pkho1_human (Q53GL0) siRNA, which results in depletion of CKIP-1 by RNA interference. plekho1-psmc5-6 5 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:31:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys699ala' Tue Jun 30 18:33:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys699Ala' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3e plekho1-psmc5-7 5 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3e plekho1-smurf1-2 5 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:10:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys699ala' Tue Jun 30 18:55:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys699Ala' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3e