IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Protection against Th17 cells differentiation by an interleukin-23 receptor cytokine-binding homology region. Protection against Th17 cells differentiation by an interleukin-23 receptor cytokine-binding homology region. PloS one 2011 imex curation Guo W., Luo C., Wang C., Zhu Y., Wang X., Gao X., Yao W. IBD - Inflammatory bowel disease wbyao@cpu.edu.cn,xiangdong_gao@yahoo.com.cn Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Guo W., Luo C., Wang C., Zhu Y., Wang X., Gao X., Yao W. IBD - Inflammatory bowel disease There may still be a C-terminal His tag present on IL23R-CHR and also an S tag (N-terminal). wbyao@cpu.edu.cn,xiangdong_gao@yahoo.com.cn Accepted 2016-JUN-23 AT 09:43 BST AT 09:43 BST by ORCHARD PloS one 2011 Only protein-protein interactions imex curation imex curation Protection against Th17 cells differentiation by an interleukin-23 receptor cytokine-binding homology region. Protection against Th17 cells differentiation by an interleukin-23 receptor cytokine-binding homology region. PloS one 2011 imex curation Guo W., Luo C., Wang C., Zhu Y., Wang X., Gao X., Yao W. IBD - Inflammatory bowel disease wbyao@cpu.edu.cn,xiangdong_gao@yahoo.com.cn Only protein-protein interactions imex curation in vitro In vitro bn-page blue native page bn-page weight silver stain molecular weight estimation by silver staining weight silver stain Guo W., Luo C., Wang C., Zhu Y., Wang X., Gao X., Yao W. IBD - Inflammatory bowel disease There may still be a C-terminal His tag present on IL23R-CHR and also an S tag (N-terminal). wbyao@cpu.edu.cn,xiangdong_gao@yahoo.com.cn Accepted 2016-JUN-23 AT 09:43 BST AT 09:43 BST by ORCHARD PloS one 2011 Only protein-protein interactions imex curation imex curation p29460-pro_0000010930 Interleukin-12 subunit beta IL12B NKSF2 Cytotoxic lymphocyte maturation factor 40 kDa subunit IL-12 subunit p40 NK cell stimulatory factor chain 2 protein protein human Homo sapiens Human IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS 23 328 59EDCABB621D7E1B q9npf7-pro_0000259488 Interleukin-23 subunit alpha Interleukin-23 subunit p19 IL23A SGRF UNQ2498/PRO5798 protein protein human Homo sapiens Human RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP 20 189 307023EB5E1A21C0 il23r_human Interleukin-23 receptor IL23R protein protein human Homo sapiens Human MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGMIVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMNNNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDLNTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLEK AC63C89E81AABF05 il12b-il23a-3 2 9 unspecified role unspecified role bait bait p19 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 p40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 12 direct interaction direct interaction 2C il23_human_complex-il23r-1 3 9 unspecified role unspecified role neutral component neutral component p19 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain p40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A interleukin-23_human IL-23 complex Interleukin-23 complex IL12B:IL23A p19p40 complex IL23 complex p19-p40 complex 4 unspecified role unspecified role il23a binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role il12b binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 22 23 direct interaction direct interaction human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Psoriasis [EFO:0000676]: a common genetically determined, chronic, inflammatory skin disease characterized by rounded erythematous, dry, scaling patches. The lesions have a predilection for nails, scalp, genitalia, extensor surfaces, and the lumbosacral region. Accelerated epidermopoiesis is considered to be the fundamental pathologic feature in psoriasis. Accepted 2014-DEC-12 by BMELDAL Rheumatoid arthritis [EFO:0000685]: a rheumatologic autoimmune disease characterized especially by pain, stiffness, inflammation, swelling, and sometimes destruction of joints. Usually chronic, primarily of the joints, marked by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Mendelian susceptibility to mycobacterial diseases due to complete IL12B deficiency (MSMD) [Orphanet:319558]: an autosomal recessive disorder due to complete interleukin-12 subunit beta (IL12B) deficiency is a genetic variant of MSMD characterized by mild bacillus Calmette-Guerin (BCG) infections and recurrent Salmonella infections. Presents in early childhood. BCG is the most common infection encountered, usually after receiving the vaccination. Non-typhoidal Salmonella infections are also seen in half of all cases. Other infections have been reported, including chronic mucocutaneous candidiasis (CMC), nocardiosis, and klebsiellosis. Incomplete clinical penetrance observed in this immunodeficiency. Crohn's disease [EFO:0000384]: a chronic transmural inflammation that may involve any part of the digestive tract from mouth to anus, mostly found in the ileum, the cecum, and the colon. In Crohn disease, the inflammation, extending through the intestinal wall from the mucosa to the serosa, is characteristically asymmetric and segmental. Epithelioid granulomas may be seen in some patients. Spondyloarthropathy [EFO:0000706]: a heterogeneous group of arthritic diseases sharing clinical and radiologic features. They are associated with the HLA-B27 antigen and some with a triggering infection. Most involve the axial joints in the spine, particularly the sacroiliac joint, but can also involve asymmetric peripheral joints. Subsets include ankylosing spondylitis; reactive arthritis; psoratic arthritis; and others. Systemic lupus erythematosus [EFO:0002690]: a chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow. Multiple sclerosis [EFO:0003885]: an autoimmune disorder mainly affecting young adults and characterized by destruction of myelin in the central nervous system. Pathologic findings include multiple sharply demarcated areas of demyelination throughout the white matter of the central nervous system. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia, and bladder dysfunction. The usual pattern is one of recurrent attacks followed by partial recovery but acute fulminating and chronic progressive forms also occur. Cytokine complex that activates and stimulates proliferation of a wide range of lymphocytes, in particular memory T cells and Th17 cells, upon binding to its receptor subunits IL12RB1 (P42701) and IL23R (Q5VWK5). Formation of the ligand-receptor complex (CPX-383) and tyrosine phosphorylation of the IL23R subunit initiates the JAK-STAT signaling cascade which ultimately activates transcription of interferon-gamma or Interleukin-17. Produced by antigen-presenting cells in response to Interleukin-18. Associated with the pathogenesis of autoimmune inflammations, including rheumatoid and Lyme arthritis, multiple sclerosis, psoriasis, and inflammatory bowel disease as well as mycobacterial diseases of varying severity, primarily bacillus Calmette-Guerin and Salmonella infections. Heterodimer