IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Smad3 binding to the foxp3 enhancer is dispensable for the development of regulatory T cells with the exception of the gut. Smad3 binding to the foxp3 enhancer is dispensable for the development of regulatory T cells with the exception of the gut. The Journal of experimental medicine 2012 imex curation Schlenner SM., Weigmann B., Ruan Q., Chen Y., von Boehmer H. IBD - Inflammatory bowel disease not as much here as I had thought/hoped originally (species of TGF-b1 not given) harald_von_boehmer@dfci.harvard.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Schlenner SM., Weigmann B., Ruan Q., Chen Y., von Boehmer H. IBD - Inflammatory bowel disease not as much here as I had thought/hoped originally (species of TGF-b1 not given) CD4+CD25− splenocytes; cells were stimulated with TGF-beta, 5 µg/ml anti-CD3 and anti-CD28. harald_von_boehmer@dfci.harvard.edu Accepted 2015-SEP-15 AT 13:02 BST AT 13:02 BST by ORCHARD The Journal of experimental medicine 2012 Only protein-protein interactions imex curation imex curation foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein Q8BUN5 original sequence version: 57 46DF5E8B371321AC smad3-foxp3-2 1 2 unspecified role unspecified role prey prey cns1_enhancer_region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association 1 Mice lacking the CNS1 binding site (CAGACTGTCTG) of Foxp3 enhancer did not bind Smad3. I have attempted to add as a Feature the Required to Bind region of the Figure 1B sequence; as the "original Sequence" - had a lot of difficulty with this - sequence isCAGACTGTCTG