IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Delayed c-Fos activation in human cells triggers XPF induction and an adaptive response to UVC-induced DNA damage and cytotoxicity. Delayed c-Fos activation in human cells triggers XPF induction and an adaptive response to UVC-induced DNA damage and cytotoxicity. Cell. Mol. Life Sci. (1420-682X) 2011 imex curation Tomicic M.T., Reischmann P., Rasenberger B., Meise R., Kaina B., Christmann M. IBD - Inflammatory bowel disease mchristm@uni-mainz.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Tomicic M.T., Reischmann P., Rasenberger B., Meise R., Kaina B., Christmann M. IBD - Inflammatory bowel disease Experimental conditions have been assumed to be the same as for the EMSA experiment in Fig. 6a and 6b. mchristm@uni-mainz.de Accepted 2014-DEC-22 by MGT Cell. Mol. Life Sci. (1420-682X) 2011 Only protein-protein interactions imex curation mmp1a_mouse_ap1-site_dna-probe Mouse MMP1A gene promoter AP-1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse AGTGGTGACTCATCACT jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 xpf_human_ap1-site_dna-probe Human XPF gene promoter AP-1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GTAAAAGAATATGAAACATCATGTTCAG xpf-fos-1 1 4 unspecified role unspecified role prey prey human-vh10-tert Homo sapiens VH10tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) vh10-tert diploid VH10-tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) V10 is a nonmalignant cell line representing normal human fibroblasts. No primary reference seems to be available for this cell line. 5 unspecified role unspecified role bait bait region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 6c Ultraviolet-C light (UVC) (254 nm) (10 J/m2) P01100 increases expression at RNA level of ENSG00000175595 P01100 increases expression at protein level of ENSG00000175595 xpf-jun-1 1 3 unspecified role unspecified role prey prey human-vh10-tert Homo sapiens VH10tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) vh10-tert diploid VH10-tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) V10 is a nonmalignant cell line representing normal human fibroblasts. No primary reference seems to be available for this cell line. 5 unspecified role unspecified role bait bait region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 6c Ultraviolet-C light (UVC) (254 nm) (10 J/m2) mmp1a-jun-1 1 3 unspecified role unspecified role prey prey human-vh10-tert Homo sapiens VH10tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) vh10-tert diploid VH10-tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) V10 is a nonmalignant cell line representing normal human fibroblasts. No primary reference seems to be available for this cell line. 2 unspecified role unspecified role bait bait region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 6c Ultraviolet-C light (UVC) (254 nm) (10 J/m2) mmp1a-fos-1 1 4 unspecified role unspecified role prey prey human-vh10-tert Homo sapiens VH10tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) vh10-tert diploid VH10-tert foreskin fibroblast cell line immortalized by stable transfection with telomerase gene (TERT) V10 is a nonmalignant cell line representing normal human fibroblasts. No primary reference seems to be available for this cell line. 2 unspecified role unspecified role bait bait region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 6c Ultraviolet-C light (UVC) (254 nm) (10 J/m2)