MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. FEBS Lett. (0014-5793) 2010 imex curation Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. FEBS Lett. (0014-5793) 2010 imex curation Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. FEBS Lett. (0014-5793) 2010 imex curation Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. FEBS Lett. (0014-5793) 2010 imex curation Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nie J., Liu L., Wu M., Xing G., He S., Yin Y., Tian C., He F., Zhang L. IBD - Inflammatory bowel disease tiancy@nic.bmi.ac.cn,hefc@nic.bmi.ac.cn,zhanglq@nic.bmi.ac.cn FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation q9uk53-2 Inhibitor of growth protein 1 p33ING1b Variant A ING1 protein protein human Homo sapiens Human MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR mint 6DA3F3F892B35810 smuf1_human E3 ubiquitin-protein ligase SMURF1 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 SMURF1 KIAA1625 HECT-type E3 ubiquitin transferase SMURF1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE 89A171CFC47B40E9 ubc_human Polyubiquitin-C UBC protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV B6E7BC06FEE77196 ing2_human Inhibitor of growth protein 2 ING2 p33ING2 Inhibitor of growth 1-like protein p32 ING1L protein protein human Homo sapiens Human MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR DC85A6ECAF7A5D81 q9hce7-2 E3 ubiquitin-protein ligase SMURF1 HECT-type E3 ubiquitin transferase SMURF1 SMURF1 KIAA1625 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE F106E00CA3C210AA ing2-ubc 2 ING2 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ubiquitin 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2d homomint mint ing2-smurf1 1 Smurf1 9 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli ING2 8 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction f3a homomint mint Q9HCE7-2 increases degradation at protein level of Q9H160 Q9HCE7-2 is required for ubiquitination of Q9H160 smurf1-ing2 3 Smurf1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ING2 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3b homomint mint ing2-smurf1-1 4 Smurf1 9 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hect domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ING2 8 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint domino mint f3c f4b ing2-smurf1-2 4 ING2 8 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Smurf1 9 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:34:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys699ala' Tue Jun 30 18:39:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys699Ala' physical association physical association f3g homomint mint q9uk53_2-smurf1 4 ING1b 5 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Smurf1 9 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:11:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys699ala' Tue Jun 30 19:08:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys699Ala' physical association physical association f4b homomint mint