IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CCAAT enhancer binding protein-beta regulates matrix metalloproteinase-1 expression in interleukin-1beta-stimulated A549 lung carcinoma cells. CCAAT enhancer binding protein-beta regulates matrix metalloproteinase-1 expression in interleukin-1beta-stimulated A549 lung carcinoma cells. Mol. Cancer Res. (1541-7786) 2009 imex curation Armstrong D.A., Phelps L.N., Vincenti M.P. IBD - Inflammatory bowel disease The materials and methods section states that the probe used for EMSA and DNA affinity chromatography corresponds to -2931 to -2892 of the human MMP-1 promoter, while the competing unlabeled probe and mutated probe span -2921 to -2892; however, the text and figure legends also define the EMSA and DNA affinity chromatography probe as -2921 to -2892, hence the probe was defined here using this sequence. The origin of the human CEBPB sequences were obtained from the suppliers' websites (for LIP and LAP2: cDNA clone MGC:15409 IMAGE:3028673 from Invitrogen; for LAP1: pCMV6-Ac-CEBPB-GFP from Origene). mpv@dartmouth.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Armstrong D.A., Phelps L.N., Vincenti M.P. IBD - Inflammatory bowel disease The materials and methods section states that the probe used for EMSA and DNA affinity chromatography corresponds to -2931 to -2892 of the human MMP-1 promoter, while the competing unlabeled probe and mutated probe span -2921 to -2892; however, the text and figure legends also define the EMSA and DNA affinity chromatography probe as -2921 to -2892, hence the probe was defined here using this sequence. The origin of the human CEBPB sequences were obtained from the suppliers' websites (for LIP and LAP2: cDNA clone MGC:15409 IMAGE:3028673 from Invitrogen; for LAP1: pCMV6-Ac-CEBPB-GFP from Origene). mpv@dartmouth.edu Accepted 2014-DEC-19 by MGT Mol. Cancer Res. (1541-7786) 2009 Only protein-protein interactions imex curation CCAAT enhancer binding protein-beta regulates matrix metalloproteinase-1 expression in interleukin-1beta-stimulated A549 lung carcinoma cells. CCAAT enhancer binding protein-beta regulates matrix metalloproteinase-1 expression in interleukin-1beta-stimulated A549 lung carcinoma cells. Mol. Cancer Res. (1541-7786) 2009 imex curation Armstrong D.A., Phelps L.N., Vincenti M.P. IBD - Inflammatory bowel disease The materials and methods section states that the probe used for EMSA and DNA affinity chromatography corresponds to -2931 to -2892 of the human MMP-1 promoter, while the competing unlabeled probe and mutated probe span -2921 to -2892; however, the text and figure legends also define the EMSA and DNA affinity chromatography probe as -2921 to -2892, hence the probe was defined here using this sequence. The origin of the human CEBPB sequences were obtained from the suppliers' websites (for LIP and LAP2: cDNA clone MGC:15409 IMAGE:3028673 from Invitrogen; for LAP1: pCMV6-Ac-CEBPB-GFP from Origene). mpv@dartmouth.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Armstrong D.A., Phelps L.N., Vincenti M.P. IBD - Inflammatory bowel disease The materials and methods section states that the probe used for EMSA and DNA affinity chromatography corresponds to -2931 to -2892 of the human MMP-1 promoter, while the competing unlabeled probe and mutated probe span -2921 to -2892; however, the text and figure legends also define the EMSA and DNA affinity chromatography probe as -2921 to -2892, hence the probe was defined here using this sequence. The origin of the human CEBPB sequences were obtained from the suppliers' websites (for LIP and LAP2: cDNA clone MGC:15409 IMAGE:3028673 from Invitrogen; for LAP1: pCMV6-Ac-CEBPB-GFP from Origene). mpv@dartmouth.edu Accepted 2014-DEC-19 by MGT Mol. Cancer Res. (1541-7786) 2009 Only protein-protein interactions imex curation mmp1_human_cebp-site_dna-probe Human MMP1 gene promoter CEBP binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TAAAAAAATATGAAGCAAGATTGAAATTTCAAGACTAAGT p17676-2 CCAAT/enhancer-binding protein beta C/EBPbeta-LAP CEBPB TCF5 Liver activator protein Liver-enriched inhibitory protein Nuclear factor NF-IL6 Transcription factor 5 PP9092 protein protein human Homo sapiens Human MEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC 842B381C36DFA8CE p17676-1 CCAAT/enhancer-binding protein beta C/EBPbeta-FL CEBPB TCF5 Liver activator protein Liver-enriched inhibitory protein Nuclear factor NF-IL6 Transcription factor 5 PP9092 protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC 9B725BD6CCAA771D p17676-3 CCAAT/enhancer-binding protein beta C/EBPbeta-LIP CEBPB TCF5 Liver activator protein Liver-enriched inhibitory protein Nuclear factor NF-IL6 Transcription factor 5 PP9092 protein protein human Homo sapiens Human MAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC 3D75D9D752E47B88 cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D mmp1-cebpb 1 7 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma 3 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association P01584 indirectly increases expression at RNA level of ENSG00000196611 P01584 indirectly increases expression at protein level of P17676 Fig. 4a interleukin-1 beta (IL-1beta) P17676 increases expression at RNA level of ENSG00000196611 P17676-1 increases expression at RNA level of ENSG00000196611 P17676-2 increases expression at RNA level of ENSG00000196611 mmp1-cebpb-1 1 3 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma 3 competitor competitor competitor prey prey t11g_g12t_a13c_a14c_g15t_c16a_a17c_a18c_g19t_a20c mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a mmp1-cebpb-2 2 6 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma 4 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma 3 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined t11g_g12t_a13c_a14c_g15t_c16a_a17c_a18c_g19t_a20c mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma association association Fig. 5a interleukin-1 beta (IL-1beta) The CEBPB isoforms LAP2 and LIP were not pulled down by the MMP1 promoter DNA probe when the probe was incubated with cell extracts from A549 cells not treated with IL-1beta. Mutation of the MMP1 promoter DNA probe decreased binding to the CEBPB isoforms LAP1 and LAP2, and abrogated binding to the LIP isoform.