IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ IFN regulatory factor 4 regulates the expression of a subset of Th2 cytokines. IFN regulatory factor 4 regulates the expression of a subset of Th2 cytokines. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu Accepted 2015-DEC-10 AT 14:37 GMT AT 14:37 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation EBI-11419711:- now the longest "short" label? I have replaced dashes with dots in the resulting sequence. For EBI-11413673 - I have seen what the exact sequence of the competitor is and altered Data Proc comment. IFN regulatory factor 4 regulates the expression of a subset of Th2 cytokines. IFN regulatory factor 4 regulates the expression of a subset of Th2 cytokines. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease The sequence for the competitor "lambda-B" (enhancer) oligonucleotide was derived from Reference 24 (pmid;12453417). mkaplan2@iupui.edu Accepted 2015-DEC-10 AT 14:37 GMT AT 14:37 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation EBI-11419711:- now the longest "short" label? I have replaced dashes with dots in the resulting sequence. For EBI-11413673 - I have seen what the exact sequence of the competitor is and altered Data Proc comment. IFN regulatory factor 4 regulates the expression of a subset of Th2 cytokines. IFN regulatory factor 4 regulates the expression of a subset of Th2 cytokines. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu Accepted 2015-DEC-10 AT 14:37 GMT AT 14:37 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation EBI-11419711:- now the longest "short" label? I have replaced dashes with dots in the resulting sequence. For EBI-11413673 - I have seen what the exact sequence of the competitor is and altered Data Proc comment. spi1_mouse Transcription factor PU.1 Spi1 Sfpi1 Sfpi-1 31 kDa-transforming protein SFFV proviral integration 1 protein protein protein mouse Mus musculus Mouse MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHNNEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCFPYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH 765E9CC2F374EB6E ig_light_chain_lambda_(iglc2)_enhancer dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse AAAAGGAAGTGAAACCA gata3_mouse Trans-acting T-cell-specific transcription factor GATA-3 Gata3 Gata-3 GATA-binding factor 3 protein protein mouse Mus musculus Mouse MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSGLSFGPHHPSSMVTAMG DIP protein P23772 original sequence version: 62 980E58FB9872E560 il10_mouse_gene Interleukin-10 gene gene gene mouse Mus musculus Mouse irf4_mouse Interferon regulatory factor 4 Irf4 Spip Lymphocyte-specific interferon regulatory factor NF-EM5 PU.1 interaction partner Transcriptional activator PIP protein protein mouse Mus musculus Mouse MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLDDTQMAMGHPYPMTAPYGSLPAQQVHNYMMPPHDRSWRDYAPDQSHPEIPYQCPVTFGPRGHHWQGPSCENGCQVTGTFYACAPPESQAPGIPIEPSIRSAEALALSDCRLHICLYYRDILVKELTTTSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQRKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNTGHFLRGYELPEHVTTPDYHRSLRHSSIQE DIP protein Q64287 original sequence version: 111 5FD94CA6C453869C irf4_consensus_binding_site_il10_promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna mouse Mus musculus Mouse TGAGGTCTGAAGAAAATCAGCCCTCTCGGG il4_mouse_gene Interleukin-4 Il4 Il-4 gene gene mouse Mus musculus Mouse irf4_consensus_binding_site_il10_promoter-irf4-2 2 9 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role prey prey mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 physical association physical association 4B irf4_consensus_binding_site_il10_promoter-irf4-1 2 9 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role prey prey mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 5 competitor competitor competitor prey prey in vitro In vitro physical association physical association 4Bi irf4_consensus_binding_site_il10_promoter-iglc2_enhancer-1 2 9 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role prey prey mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 9 competitor competitor competitor prey prey G9A,A10T,A11C,G12A,A13G,A14C,A15C,A16C,T_C_A_G_C_C_C_17-23del_del_del_del_del_del_del_ mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain GAAGAAAATCAGCCC ATCAGCCC....... in vitro In vitro physical association physical association 4Bii irf4-il10_mouse_gene-1 3 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cn3_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 4C, 5C P17433 decreases the binding of Q64287 to ENSMUSG00000016529 Q64287 increases at protein level the expression of ENSMUSG00000016529 caus. from Fig 2D, 3A irf4-il4-2 3 10 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Va_site_3_prime_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 4C, 5C P17433 decreases the binding of Q64287 to ENSMUSG00000000869 spi1-gata3-1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 5A spi1-gata3-2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 5Ai Not much IRF4 was precipitated with this complex. gata3-irf4-1 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 5Aii