IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. J. Biol. Chem. (0021-9258) 2009 imex curation Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-chang liver ce Homo sapiens chang liver cells chang liver cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it Accepted 2015-FEB-16 by ORCHARD J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. J. Biol. Chem. (0021-9258) 2009 imex curation Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-chang liver ce Homo sapiens chang liver cells chang liver cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it Accepted 2015-FEB-16 by ORCHARD J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. J. Biol. Chem. (0021-9258) 2009 imex curation Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-conjunctival_epithelium Homo sapiens conjunctival epithelium cells conjunctival_epithelium conjunctival epithelium cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it Accepted 2015-FEB-16 by ORCHARD J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. J. Biol. Chem. (0021-9258) 2009 imex curation Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it Accepted 2015-FEB-16 by ORCHARD J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. Pseudomonas aeruginosa induces interleukin-8 (IL-8) gene expression in human conjunctiva through the recruitment of both RelA and CCAAT/enhancer-binding protein beta to the IL-8 promoter. J. Biol. Chem. (0021-9258) 2009 imex curation Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-conjunctival_epithelium Homo sapiens conjunctival epithelium cells conjunctival_epithelium conjunctival epithelium cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Venza I., Cucinotta M., Visalli M., De Grazia G., Oliva S., Teti D. IBD - Inflammatory bowel disease dteti@unime.it Accepted 2015-FEB-16 by ORCHARD J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D il8_human_ap1-site_dna-probe Human IL8 gene promoter activator protein 1 site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AGTGTGATGACTCAGGTTTGC il8_human_-97_dna-probe Human IL8 gene promoter region -97 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TCAGTTGCAAATCGTGGAATTTCCTCTGACATAATGAAAAGAT il8_human_gene Human IL-8 gene gene gene human Homo sapiens Human jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 jun-il8 1 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 8 rela-il8-6 1 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 8 treatment with bacterium Pseudomonas aeruginosa Q04206 increases expression at RNA level of ENSG00000169429 Q04206 increases expression at protein level of ENSG00000169429 cebpb-il8 1 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association Fig. 8 treatment with bacterium Pseudomonas aeruginosa P17676 increases expression at RNA level of ENSG00000169429 P17676 increases expression at protein level of ENSG00000169429 jun-il8-1 5 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 8 rela-il8-7 5 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Fig. 8 treatment with bacterium Pseudomonas aeruginosa cebpb-il8-1 5 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 8 treatment with bacterium Pseudomonas aeruginosa il8-cebpb 4 6 unspecified role unspecified role prey prey human-chang liver ce Homo sapiens chang liver cells chang liver cells 8 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 9a, 9c Mutation of the RelA binding site in the probe did not affect the supershift caused by anti-C/EBP-beta antibody. il8-rela 4 11 unspecified role unspecified role prey prey human-chang liver ce Homo sapiens chang liver cells chang liver cells 8 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 9a, 9b Mutation of the C/EBP-beta binding site in the probe did not affect the supershift caused by anti-RelA antibody. il8-jun 4 7 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey human-chang liver ce Homo sapiens chang liver cells chang liver cells physical association physical association Fig. 9d rela-cebpb 2 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association Fig. 8 This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-C/EBP-beta antibody. treatment with bacterium Pseudomonas aeruginosa cebpb-il8-2 2 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association Fig. 8 treatment with bacterium Pseudomonas aeruginosa This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-RelA antibody. cebpb-il8-3 3 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association Fig. 8 This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-RelA antibody. treatment with bacterium Pseudomonas aeruginosa rela-cebpb-1 3 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Fig. 8 This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-C/EBP-beta antibody. treatment with bacterium Pseudomonas aeruginosa