MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels. Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels. Cancer Res. (0008-5472) 2008 imex curation Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N., Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Interactions including HA-p27Kip1 and recombinant p27Kip1 have not been included as the origin of the construct/protein cannot be traced. naoya.fujita@jfcr.or.jp Only protein-protein interactions partial coverage rapid curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N., Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Interactions including HA-p27Kip1 and recombinant p27Kip1 have not been included as the origin of the construct/protein cannot be traced. naoya.fujita@jfcr.or.jp Cancer Res. (0008-5472) 2008 imex curation Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels. Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels. Cancer Res. (0008-5472) 2008 imex curation Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N., Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Interactions including HA-p27Kip1 and recombinant p27Kip1 have not been included as the origin of the construct/protein cannot be traced. naoya.fujita@jfcr.or.jp Only protein-protein interactions partial coverage rapid curation human-22rv1 Homo sapiens 22rv1 Human prostate adenocarcinoma cell line Also known as CWR22Rv1 or Rv1. Cells dsplay a NE (neuroendocrine phenotype). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer In figure 2B the short isoform of PIM1 is stated to have been detected, but as no M.Wt info is visible and the antibody used detects both isoforms, no isoform information has been entered here. naoya.fujita@jfcr.or.jp Cancer Res. (0008-5472) 2008 IMEx Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels. Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels. Cancer Res. (0008-5472) 2008 imex curation Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N., Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Interactions including HA-p27Kip1 and recombinant p27Kip1 have not been included as the origin of the construct/protein cannot be traced. naoya.fujita@jfcr.or.jp Only protein-protein interactions partial coverage rapid curation human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer In figure 2B the short isoform of PIM1 is stated to have been detected, but as no M.Wt info is visible and the antibody used detects both isoforms, no isoform information has been entered here. naoya.fujita@jfcr.or.jp Cancer Res. (0008-5472) 2008 IMEx ly294002 LY294002 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one 2-(4-Morpholinyl)-8-phenyl-4H-1-benzopyran-4-one LY 294002 2-(morpholin-4-yl)-8-phenyl-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p11309-1 Serine/threonine-protein kinase pim-1 Pim-1 PIM1 protein protein human Homo sapiens Human MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK Initiates from CTG codon. 18C421B7CFF87818 cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC foxo3_human Forkhead box protein O3 FOXO3 FKHRL1 FOXO3A Forkhead in rhabdomyosarcoma-like 1 AF6q21 protein protein protein human Homo sapiens Human MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG E5B4E830665A9982 DIP protein O43524 original sequence version: 82 E5B4E830665A9982 cdkn1b-pim1-1 3 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2B pim1-cdkn1b-2 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2B foxo3-pim1-2 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2Bi foxo3-pim1-1 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2Bi pim1-1 1 5 putative self putative self putative self putative self n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Supp 1 ly294002-pim1-1 1 4 inhibitor inhibitor neutral component neutral component 5 putative self putative self putative self putative self n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supp 1i