MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The phosphatase PHLPP controls the cellular levels of protein kinase C. The phosphatase PHLPP controls the cellular levels of protein kinase C. J. Biol. Chem. (0021-9258) 2008 rapid curation Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico anewton@ucsd.edu 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico The authors use the phlp1_human alpha isoform, which lacks the N-terminal 512 amino acids. As there is currently no alpha isoform in UniProt, sequence positions mentioned in the paper for the alpha isoform have been remapped to the canonical beta isoform annotated in UniProt. The PKCB2 (P05771-2) constructs are described in PMID:11376011 and PMID:14594954. anewton@ucsd.edu Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation rapid curation The phosphatase PHLPP controls the cellular levels of protein kinase C. The phosphatase PHLPP controls the cellular levels of protein kinase C. J. Biol. Chem. (0021-9258) 2008 rapid curation Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico anewton@ucsd.edu 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay western blot western blot Immuno blot Immuno blot Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico Expression and purification of phlp1_human is described in PMID:15808505. The authors use the phlp1_human alpha isoform, which lacks the N-terminal 512 amino acids. As there is currently no alpha isoform in UniProt, sequence positions mentioned in the paper for the alpha isoform have been remapped to the canonical beta isoform annotated in UniProt. anewton@ucsd.edu Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation rapid curation The phosphatase PHLPP controls the cellular levels of protein kinase C. The phosphatase PHLPP controls the cellular levels of protein kinase C. J. Biol. Chem. (0021-9258) 2008 rapid curation Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico anewton@ucsd.edu 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico The authors use the phlp1_human alpha isoform, which lacks the N-terminal 512 amino acids. As there is currently no alpha isoform in UniProt, sequence positions mentioned in the paper for the alpha isoform have been remapped to the canonical beta isoform annotated in UniProt. anewton@ucsd.edu Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation rapid curation The phosphatase PHLPP controls the cellular levels of protein kinase C. The phosphatase PHLPP controls the cellular levels of protein kinase C. J. Biol. Chem. (0021-9258) 2008 rapid curation Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico anewton@ucsd.edu 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 cosedimentation cosedimentation anti tag western anti tag western blot anti tag western Gao T., Brognard J., Newton AC. IBD - Inflammatory bowel disease suggested by santonico anewton@ucsd.edu Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation rapid curation ppm1a_human Protein phosphatase 1A Protein phosphatase 2C isoform alpha PPM1A PPPM1A Protein phosphatase IA protein protein human Homo sapiens Human MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW D48EF508B4A76687 phlp2_human PH domain leucine-rich repeat-containing protein phosphatase 2 PHLPP2 KIAA0931 PHLPPL PH domain leucine-rich repeat-containing protein phosphatase-like protein protein human Homo sapiens Human MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGEKPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHVDLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHVQNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSLHPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSPTLCSEEHARGSCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL DIP protein Q6ZVD8 original sequence version: 104 04FC8550C2E22A6D p05771-2 Protein kinase C beta type PKCB PRKCB1 PRKCB2 PRKCB protein protein human Homo sapiens Human MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS DIP protein P05771-2 original sequence version: 176 Contains a phosphothreonine at position 641. Contains a phosphoserine at position 660. 03D42B0E4164B48F phlp1_human PH domain leucine-rich repeat-containing protein phosphatase 1 PHLPP1 KIAA0606 PHLPP PLEKHE1 SCOP Pleckstrin homology domain-containing family E member 1 Suprachiasmatic nucleus circadian oscillatory protein protein protein human Homo sapiens Human MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAPSGGNGSGSGAREEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLLLRRGRLKRNLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSEVPPARSAPGAFGGPPRAPPADLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESFSLSPSAESVSDRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAPRAIDSPGGAVREGSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETTRRLEAEEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLSGMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQHCLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQDLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELNVSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFNEFTDIPEVLEKLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRDNKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMDVSRNRLENVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLARLPERLERTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLTNNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIMNCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPRLVLDHKTLELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCDNREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQKLGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIKQHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSLSVEEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAVPPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISSELSTSEMSSEVGSTASDEPPPGALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNGSRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTPL A4AB53F334EA8AB6 phlpp1-prkcb 2 7 enzyme target enzyme target substrate substrate neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pp2c-like_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) dephosphorylation dephosphorylation reaction dephosphorylation F1A mint O60346 is required for dephosphorylation of P05771-2 O60346 increases degradation at protein level of P05771-2 phlpp1-prkcb-1 4 7 unspecified role unspecified role neutral component neutral component Resulting Phenotypic qualities properties)[PATO]: PATO:0002263 (dephosphorylated) 8 unspecified role unspecified role neutral component neutral component physical association physical association F1B mint phlpp1-prkcb-2 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:52:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1-146 region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint F2A; F3B,C ppm1a-prkcb-1 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F2A mint phlpp2-prkcb-2 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4B mint prkcb-phlpp1 1 7 unspecified role unspecified role bait bait pe/dag_bd mutation disrupting interaction sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 601-671 ser/thr_dual-sp_kinase mutation disrupting interaction sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 172-260 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B mint phlpp1-prkcb-3 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait pp2c-like_dom mutation disrupting interaction sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 907-1205 ph_domain mutation disrupting interaction sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 126-652 region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C mint phlpp2-prkcb-1 4 7 unspecified role unspecified role neutral component neutral component Resulting Phenotypic qualities properties)[PATO]: PATO:0002263 (dephosphorylated) 6 unspecified role unspecified role neutral component neutral component physical association physical association F4A mint