IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Positive and negative regulation of human hepatic hydroxysteroid sulfotransferase (SULT2A1) gene transcription by rifampicin: roles of hepatocyte nuclear factor 4alpha and pregnane X receptor. Positive and negative regulation of human hepatic hydroxysteroid sulfotransferase (SULT2A1) gene transcription by rifampicin: roles of hepatocyte nuclear factor 4alpha and pregnane X receptor. J. Pharmacol. Exp. Ther. (0022-3565) 2007 imex curation Fang H.L., Strom S.C., Ellis E., Duanmu Z., Fu J., Duniec-Dmuchowski Z., Falany C.N., Falany J.L., Kocarek T.A., Runge-Morris M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease The human SULT2A1 promoter reporter construct is described in PMID:15635043. The human CYP3A4 promoter reporter construct is described in PMID:10570062. The identity of human RXR-alpha was derived from PMID:1310351, PMID:10882139 and PMID:11546778. m.runge-morris@wayne.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Fang H.L., Strom S.C., Ellis E., Duanmu Z., Fu J., Duniec-Dmuchowski Z., Falany C.N., Falany J.L., Kocarek T.A., Runge-Morris M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The human SULT2A1 promoter reporter construct is described in PMID:15635043. The human CYP3A4 promoter reporter construct is described in PMID:10570062. The identity of human RXR-alpha was derived from PMID:1310351, PMID:10882139 and PMID:11546778. m.runge-morris@wayne.edu Accepted 2015-JAN-19 by ORCHARD J. Pharmacol. Exp. Ther. (0022-3565) 2007 Only protein-protein interactions imex curation Positive and negative regulation of human hepatic hydroxysteroid sulfotransferase (SULT2A1) gene transcription by rifampicin: roles of hepatocyte nuclear factor 4alpha and pregnane X receptor. Positive and negative regulation of human hepatic hydroxysteroid sulfotransferase (SULT2A1) gene transcription by rifampicin: roles of hepatocyte nuclear factor 4alpha and pregnane X receptor. J. Pharmacol. Exp. Ther. (0022-3565) 2007 imex curation Fang H.L., Strom S.C., Ellis E., Duanmu Z., Fu J., Duniec-Dmuchowski Z., Falany C.N., Falany J.L., Kocarek T.A., Runge-Morris M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease The human SULT2A1 promoter reporter construct is described in PMID:15635043. The human CYP3A4 promoter reporter construct is described in PMID:10570062. The identity of human RXR-alpha was derived from PMID:1310351, PMID:10882139 and PMID:11546778. m.runge-morris@wayne.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Fang H.L., Strom S.C., Ellis E., Duanmu Z., Fu J., Duniec-Dmuchowski Z., Falany C.N., Falany J.L., Kocarek T.A., Runge-Morris M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The human SULT2A1 promoter reporter construct is described in PMID:15635043. The human CYP3A4 promoter reporter construct is described in PMID:10570062. The identity of human RXR-alpha was derived from PMID:1310351, PMID:10882139 and PMID:11546778. m.runge-morris@wayne.edu Accepted 2015-JAN-19 by ORCHARD J. Pharmacol. Exp. Ther. (0022-3565) 2007 Only protein-protein interactions imex curation Positive and negative regulation of human hepatic hydroxysteroid sulfotransferase (SULT2A1) gene transcription by rifampicin: roles of hepatocyte nuclear factor 4alpha and pregnane X receptor. Positive and negative regulation of human hepatic hydroxysteroid sulfotransferase (SULT2A1) gene transcription by rifampicin: roles of hepatocyte nuclear factor 4alpha and pregnane X receptor. J. Pharmacol. Exp. Ther. (0022-3565) 2007 imex curation Fang H.L., Strom S.C., Ellis E., Duanmu Z., Fu J., Duniec-Dmuchowski Z., Falany C.N., Falany J.L., Kocarek T.A., Runge-Morris M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease The human SULT2A1 promoter reporter construct is described in PMID:15635043. The human CYP3A4 promoter reporter construct is described in PMID:10570062. The identity of human RXR-alpha was derived from PMID:1310351, PMID:10882139 and PMID:11546778. m.runge-morris@wayne.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Fang H.L., Strom S.C., Ellis E., Duanmu Z., Fu J., Duniec-Dmuchowski Z., Falany C.N., Falany J.L., Kocarek T.A., Runge-Morris M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The human SULT2A1 promoter reporter construct is described in PMID:15635043. The human CYP3A4 promoter reporter construct is described in PMID:10570062. The identity of human RXR-alpha was derived from PMID:1310351, PMID:10882139 and PMID:11546778. m.runge-morris@wayne.edu Accepted 2015-JAN-19 by ORCHARD J. Pharmacol. Exp. Ther. (0022-3565) 2007 Only protein-protein interactions imex curation ppara_mouse Peroxisome proliferator-activated receptor alpha Ppara Nr1c1 Ppar Nuclear receptor subfamily 1 group C member 1 protein protein mouse Mus musculus Mouse MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSCPGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFVIHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY DIP protein P23204 original sequence version: 126 2930A5191C610B6B pxr-re_consensus_dna-probe PXR consensus response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CTAATATGAACTCAAAGGAGGTCAGTGA hnf4a_human Hepatocyte nuclear factor 4-alpha Transcription factor HNF-4 Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 HNF4A HNF4 NR2A1 TCF14 protein protein human Homo sapiens Human MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI 5F1309B89D95DCAF st2a1_human_gene Bile salt sulfotransferase human gene gene gene human Homo sapiens Human st2a1_human_hnf4a-6160-site_dna-probe Human ST2A1 gene promoter HNF4A-6160 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GTTGCTGGCTGCAGGGCTAAGTTCAGTGGTTTTATGG rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT DIP protein P19793 original sequence version: 177 DIP protein P19793 original sequence version: 107 DIP protein P19793 original sequence version: 153 DIP protein P19793 original sequence version: 131 DIP protein P19793 original sequence version: 136 DIP protein P19793 original sequence version: 169 DIP protein P19793 original sequence version: 161 DIP protein P19793 original sequence version: 139 7F952B580AD84C42 ppar-re_consensus_dna-probe PPAR consensus response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TCCAAAACTAGGTCAAAGGTCATCGATCG st2a1_human_hnf4a-54-site_dna-probe Human ST2A1 gene promoter HNF4A-54 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TGTGACATGCTGGGACAAGGTTAAAGATCGTTTTATCCTTGCTGT nr1i2_human Nuclear receptor subfamily 1 group I member 2 NR1I2 PXR Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptor protein protein human Homo sapiens Human MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS 1DF6A2AE3109C4DA hnf4a-re_consensus_dna-probe HNF4-alpha consensus response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CTCAGCTTGTACTTTGGTACAACTA hnf4a-st2a1 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6 P41235 increases expression at RNA level of ENSG00000105398 hnf4a_re-hnf4a 3 13 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association Fig. 4b, 5b st2a1-hnf4a 3 6 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4b st2a1-hnf4a-1 3 11 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association Fig. 5b st2a1-hnf4a-2 1 8 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association Fig. 4b st2a1-hnf4a-3 1 8 competitor competitor competitor prey prey c17a_a19c_a20c mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro association association Fig. 4b st2a1-hnf4a-4 1 13 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4b st2a1-hnf4a-5 1 11 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined a23c_a24c_a25c mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association Fig. 5b, 5c st2a1-hnf4a-6 1 6 unspecified role unspecified role prey prey in vitro In vitro 11 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 competitor competitor competitor prey prey a23c_a24c_a25c mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 5b st2a1-hnf4a-7 1 6 unspecified role unspecified role prey prey in vitro In vitro 13 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 5b pxr_re-nr1i2 3 12 unspecified role unspecified role prey prey in vitro In vitro 5 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4c pxr_re-rxra 3 9 unspecified role unspecified role prey prey in vitro In vitro 5 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4c hnf4a_re-hnf4a-1 1 13 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association Fig. 4b, 5b, 5c ppar_re-ppara 1 4 unspecified role unspecified role prey prey in vitro In vitro 10 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey in vitro In vitro association association Fig. 5c st2a1-ppara 1 4 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role prey prey in vitro In vitro 11 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined a23c_a24c_a25c mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 5c pxr_re-nr1i2-1 1 12 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role prey prey in vitro In vitro 5 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4c, 5c pxr_re-nr1i2-2 1 5 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role bait bait 3-prime 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey in vitro In vitro 12 unspecified role unspecified role prey prey in vitro In vitro association association Fig. 4c