IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes. Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes. J. Immunol. (0022-1767) 2007 imex curation Ni Z., Bremner R. IBD - Inflammatory bowel disease Fig. 1A/B and 2C also show that BRG1 increases IFITM3 and IFI16 RNA level, and that IL-6 and BRG1 increase IFITM3, IFI16 and IRF1 RNA levels; however, these experiments are only done in SW13 cells, while anti-BRG1 ChIP assay is only done in HeLa cells (Fig. 5); can these statements be added to that experiment? (these statements were not yet added) reply: No - effects may well be cell line specific- HeLa cells behave differently from SW13 (as shown here) so the statements may not be appropriate. The adenoviral BRG1 expression construct was confirmed to be of human origin by the corresponding author via e-mail. bremner@lunenfeld.ca 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ni Z., Bremner R. IBD - Inflammatory bowel disease Fig. 1A/B and 2C also show that BRG1 increases IFITM3 and IFI16 RNA level, and that IL-6 and BRG1 increase IFITM3, IFI16 and IRF1 RNA levels; however, these experiments are only done in SW13 cells, while anti-BRG1 ChIP assay is only done in HeLa cells (Fig. 5); can these statements be added to that experiment? (these statements were not yet added) reply: No - effects may well be cell line specific- HeLa cells behave differently from SW13 (as shown here) so the statements may not be appropriate. The adenoviral BRG1 expression construct was confirmed to be of human origin by the corresponding author via e-mail. bremner@lunenfeld.ca Accepted 2015-JAN-26 by MGT J. Immunol. (0022-1767) 2007 Only protein-protein interactions imex curation Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes. Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes. J. Immunol. (0022-1767) 2007 imex curation Ni Z., Bremner R. IBD - Inflammatory bowel disease Fig. 1A/B and 2C also show that BRG1 increases IFITM3 and IFI16 RNA level, and that IL-6 and BRG1 increase IFITM3, IFI16 and IRF1 RNA levels; however, these experiments are only done in SW13 cells, while anti-BRG1 ChIP assay is only done in HeLa cells (Fig. 5); can these statements be added to that experiment? (these statements were not yet added) reply: No - effects may well be cell line specific- HeLa cells behave differently from SW13 (as shown here) so the statements may not be appropriate. The adenoviral BRG1 expression construct was confirmed to be of human origin by the corresponding author via e-mail. bremner@lunenfeld.ca 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-sw13 human sw13 cells from bone sw13 SW1353 Species: human, Caucasian female 72 years old; Tissue: bone; Tumor: chondrosarcoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ni Z., Bremner R. IBD - Inflammatory bowel disease Fig. 1A/B and 2C also show that BRG1 increases IFITM3 and IFI16 RNA level, and that IL-6 and BRG1 increase IFITM3, IFI16 and IRF1 RNA levels; however, these experiments are only done in SW13 cells, while anti-BRG1 ChIP assay is only done in HeLa cells (Fig. 5); can these statements be added to that experiment? (these statements were not yet added) reply: No - effects may well be cell line specific- HeLa cells behave differently from SW13 (as shown here) so the statements may not be appropriate. The adenoviral BRG1 expression construct was confirmed to be of human origin by the corresponding author via e-mail. bremner@lunenfeld.ca Accepted 2015-JAN-26 by MGT J. Immunol. (0022-1767) 2007 Only protein-protein interactions imex curation irf1_human_gene Interferon regulatory factor 1 (IRF1) human gene gene gene human Homo sapiens Human stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D ifm3_human_gene Interferon-induced transmembrane protein 3 (IFITM3) human gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 ifit1_human_gene Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1) human gene gene gene human Homo sapiens Human irf9_human_gene Interferon regulatory factor 9 (IRF9) human gene gene gene human Homo sapiens Human if16_human_gene Gamma-interferon-inducible protein 16 (IFI16) human gene gene gene human Homo sapiens Human smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein P51532 original sequence version: 125 DIP protein P51532 original sequence version: 115 DIP protein P51532 original sequence version: 154 DIP protein P51532 original sequence version: 136 DIP protein P51532-1 original sequence version: 136 ABDA5EDBF10D7D28 stat3-ifm3-1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3a, 3b human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of STAT3 to the IFITM3 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of STAT3 to the IFITM3 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P40763 to ENSG00000142089 P05231 and P51532 and P40763 increases expression at RNA level of ENSG00000142089 stat3-if16-1 2 4 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3a, 3b human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of STAT3 to the IFI16 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of STAT3 to the IFI16 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P40763 to ENSG00000163565 P05231 and P51532 and P40763 increases expression at RNA level of ENSG00000163565 stat3-irf1-1 2 3 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association Fig. 3b human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of STAT3 to the IRF1 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of STAT3 to the IRF1 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P40763 to ENSG00000125347 stat3-irf9-1 2 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association Fig. 3b human interleukin-6 (IL-6) (P05231) P05231 increases binding of P40763 to ENSG00000213928 P05231 indirectly increases expression at RNA level of ENSG00000213928 hist1h4a-if16-1 2 6 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4 human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of H4 to the IFI16 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of H4 to the IFI16 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P62805 to ENSG00000163565 hist1h4a-ifm3-1 2 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4 human interleukin-6 (IL-6) (P05231) human BRG1/SMARCA4 (P51532) IL-6-induced binding of H4 to the IFITM3 promoter only occurred in the presence of BRG1, while expression of BRG1 resulted in increased binding of H4 to the IFITM3 promoter only when cells were treated with IL-6. P05231 and P51532 increases binding of P62805 to ENSG00000142089 hist1h4a-irf9-1 2 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4 human interleukin-6 (IL-6) (P05231) P05231 increases binding of P62805 to ENSG00000213928 smarca4-irf1-1 1 10 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5 smarca4-ifit1-1 1 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5 smarca4-if16-1 1 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5