IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. J. Immunol. (0022-1767) 2006 imex curation Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de Accepted 2015-JAN-05 by ORCHARD J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. J. Immunol. (0022-1767) 2006 imex curation Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease In the presence of recombinant GST-tagged mouse CREM, recombinant GST-tagged mouse HDAC1 also co-precipitated with biotinylated dsDNA containing a consensus CRE site (TGACGTCA), which was precipitated using streptavidin-coated magnetic beads; however, the complete sequence of the DNA probe could not be established, hence this interaction is not captured here. The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de Accepted 2015-JAN-05 by ORCHARD J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. J. Immunol. (0022-1767) 2006 imex curation Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de Accepted 2015-JAN-05 by ORCHARD J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. J. Immunol. (0022-1767) 2006 imex curation Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de Accepted 2015-JAN-05 by ORCHARD J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. J. Immunol. (0022-1767) 2006 imex curation Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de Accepted 2015-JAN-05 by ORCHARD J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 fos_human_gene Human FOS gene gene gene human Homo sapiens Human crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY 4DDEE62904CDD0E6 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 crem_mouse cAMP-responsive element modulator Crem Inducible cAMP early repressor protein protein mouse Mus musculus Mouse MSKCGRKKYMRTNVRQMTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQIQTVQVATIAETDDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD 0B387B7247113088 il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human crem-hdac1 4 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 2b crem-hdac1-1 2 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association Fig. 2c hdac1-crem 2 6 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association Fig. 2d hdac1-crem-1 2 6 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction Fig. 2e crem-hdac1-2 2 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range h domain required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction Fig. 2f, 3a hdac1-crem-2 5 6 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range h domain required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 3b crem-fos 1 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Fig. 4a crem-fos-1 1 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association Fig. 4a Q03060 decreases expression at protein level of ENSG00000170345 hdac1-fos 1 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 4a, 4b sense mouse CREM (P27699) expression vector antisense mouse CREM (P27699) expression vector Q03060 increases binding of Q13547 to ENSG00000170345 hdac1-il2 1 12 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 4a, 4c sense mouse CREM (P27699) expression vector antisense mouse CREM (P27699) expression vector Q03060 increases binding of Q13547 to ENSG00000109471 hdac1-il2-1 3 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 5a crem-il2 3 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5a rela-il2-2 3 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5a