IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter. Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter. FASEB J. (0892-6638) 2006 imex curation Novac N., Baus D., Dostert A., Heinzel T. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease t.heinzel@uni-jena.de 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Novac N., Baus D., Dostert A., Heinzel T. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease t.heinzel@uni-jena.de Accepted 2015-JAN-26 by ORCHARD FASEB J. (0892-6638) 2006 Only protein-protein interactions imex curation Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter. Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter. FASEB J. (0892-6638) 2006 imex curation Novac N., Baus D., Dostert A., Heinzel T. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease t.heinzel@uni-jena.de 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Novac N., Baus D., Dostert A., Heinzel T. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The experiment was also performed with other oligonucleotides containing predicted nGRE sites, and weak binding of GR was detected to nGRE's located at -530, -470 and -230; however, the sequences of these oligos were not available, hence these interactions are not captured here. GR expression constructs are described in PMID:8076604. t.heinzel@uni-jena.de Accepted 2015-JAN-26 by ORCHARD FASEB J. (0892-6638) 2006 Only protein-protein interactions imex curation p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK C5C90C9A5DD16AAB tnfl6_human_ngre/-990_dna-probe Human TNFL6 gene promoter negative GRE/-990 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AACATAGCAAGTCCCCATCTGTACAAAAAAAAA 2x-nfkb-re_dna-probe Tandem of NFkB response element from IkBa promoter DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TGGGGACTTTCCGCTGGGGACTTTCCGC atty_rat_gre_dna-probe Rat ATTY gene promoter glucocorticoid response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid rat Rattus norvegicus (Rat) Rat AATCTCTGCTGTACAGGATGTTCTAGCTACT tnfl6_human_gene Tumor necrosis factor ligand superfamily member 6 (FASLG) human gene gene gene human Homo sapiens Human nr3c1-tnfl6 1 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5c dexamethasone (Dex) (CHEBI:41879) (10E-7 M for 30 minutes) P04150 decreases expression at RNA level of ENSG00000117560 CHEBI:41879 indirectly decreases expression at RNA level of ENSG00000117560 CHEBI:41879 increases binding of P04150 to ENSG00000117560 nfkb1-tnfl6 1 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association Fig. 5c dexamethasone (Dex) (CHEBI:41879) (10E-7 M for 30 minutes) P04150 decreases binding of P19838-PRO_0000030311 to ENSG00000117560 CHEBI:41879 decreases binding of P19838-PRO_0000030311 to ENSG00000117560 2x_nfkb_re-nfkb1 2 3 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 6 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 5b tnfl6-nfkb1 2 3 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 5b tnfl6-nfkb1-1 2 4 competitor competitor competitor prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association Fig. 5b tnfl6-nr3c1 2 4 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined g21t_a25g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 5b tnfl6-nr3c1-1 2 4 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined g21t_a25g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4a, 4b atty-nr3c1 2 4 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia 7 unspecified role unspecified role bait bait region biotin tag biotin tag mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c14g_g20c mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4b