IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity. The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity. Nature immunology 2005 imex curation Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence fluorescence technology fluorescence antibody detection identification by antibody antibody detection Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease galectins are strictly speaking NOT tagged with GFP (just co-expressed). I am dubious if you can call these interactions-although the authors think so.(maybe have colocalisation for Interaction type?) The PSI-MI spreadsheet states that for FACS Experimental roles should be "fluorescence acceptor/donor" - but I dont think that is correct, as a FACS machine will collect fluorescent signals at different wavelengths from multiple sources -no transfer is involved. Galectins were cloned into an IRES2 expression vector that bicistronically expressed EGFP; it has been assumed that GFP fluorescence detection corresponds to presence of galectins. TIM-Ig fusion protein were detected by phycoerythrin conjugated–anti-human IgG. The interactions were detected by Flow Cytometry; only Tim-3–Ig fusion proteins co-stained galectin transfectants. vkuchroo@rics.bwh.harvard.edu Accepted 2015-NOV-26 AT 08:53 GMT AT 08:53 GMT by ORCHARD Nature immunology 2005 Only protein-protein interactions imex curation imex curation I have made Exp. Roles as Unspecified, and made Interaction type as "colocalisation". I have altered Interaction Det. Met to "Fluorescence Technology" as no cell sorting is done here - Flow Cytometry is stated Method here, of which FACS is sub-type/specialised type of - and is not in the MI Ontology. I have added to the Exp. Mod. a little. The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity. The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity. Nature immunology 2005 imex curation Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu Accepted 2015-NOV-26 AT 08:53 GMT AT 08:53 GMT by ORCHARD Nature immunology 2005 Only protein-protein interactions imex curation imex curation I have made Exp. Roles as Unspecified, and made Interaction type as "colocalisation". I have altered Interaction Det. Met to "Fluorescence Technology" as no cell sorting is done here - Flow Cytometry is stated Method here, of which FACS is sub-type/specialised type of - and is not in the MI Ontology. I have added to the Exp. Mod. a little. The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity. The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity. Nature immunology 2005 imex curation Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Zhu C., Anderson AC., Schubart A., Xiong H., Imitola J., Khoury SJ., Zheng XX., Strom TB., Kuchroo VK. IBD - Inflammatory bowel disease vkuchroo@rics.bwh.harvard.edu Accepted 2015-NOV-26 AT 08:53 GMT AT 08:53 GMT by ORCHARD Nature immunology 2005 Only protein-protein interactions imex curation imex curation I have made Exp. Roles as Unspecified, and made Interaction type as "colocalisation". I have altered Interaction Det. Met to "Fluorescence Technology" as no cell sorting is done here - Flow Cytometry is stated Method here, of which FACS is sub-type/specialised type of - and is not in the MI Ontology. I have added to the Exp. Mod. a little. leg1_mouse Galectin-1 Lgals1 Gbp Lectin galactoside-binding soluble 1 Beta-galactoside-binding lectin L-14-I S-Lac lectin 1 Galaptin 14 kDa lectin Lactose-binding lectin 1 protein protein mouse Mus musculus Mouse MACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKCVAFE FD6967C1F4117122 q9xbm8_elime png protein protein elime Elizabethkingia meningoseptica APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTAVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVVQYNKSSIDGVPYGKAHTLALKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNSNTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLIGSTFSYEYKFQNWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN 748A02AB2991EB70 leg3_mouse Galectin-3 Lgals3 35 kDa lectin Carbohydrate-binding protein 35 Galactose-specific lectin 3 IgE-binding protein L-34 galactoside-binding lectin Laminin-binding protein Lectin L-29 Mac-2 antigen protein protein mouse Mus musculus Mouse MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI 1B5A8A81093D68F6 leg4_mouse Galectin-4 Lgals4 Lactose-binding lectin 4 protein protein mouse Mus musculus Mouse MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI 7F3DD89862A853B5 alpha-lactose alpha-lactose 1-beta-D-Galactopyranosyl-4-alpha-D-glucopyranose 4-O-beta-D-galactopyranosyl-alpha-D-glucopyranose alpha-Lactose Anhydrous lactose beta-D-Galp-(1->4)-alpha-D-Glcp Lactose LACTOSE Milk sugar beta-D-galactopyranosyl-(1->4)-alpha-D-glucopyranose beta-D-galactopyranosyl-(1->4)-alpha-D-glucose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) havr2_mouse Hepatitis A virus cellular receptor 2 homolog Havcr2 Tim3 Timd3 T-cell immunoglobulin and mucin domain-containing protein 3 T-cell membrane protein 3 T-cell immunoglobulin mucin receptor 3 protein protein mouse Mus musculus Mouse MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAIHIGVGVSAGLTLALIIGVLILKWYSCKKKKLSSLSLITLANLPPGGLANAGAVRIRSEENIYTIEENVYEVENSNEYYCYVNSQQPS DIP protein Q8VIM0 original sequence version: 99 C0349E4BD0E5761D o08573-2 Galectin-9 Lgals9 Short D5 protein protein mouse Mus musculus Mouse MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT B4961AFB6F1FF13F leg9_mouse Galectin-9 Lgals9 protein protein mouse Mus musculus Mouse MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT Binds galactosides. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death mint B54036F6E280C531 havcr2-lgals9-1 2 11 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-tk-1 mouse-TK-1 T lymphocyte/lymphoblast ,T-cell lymphoma cell line Mouse tk-1 TK-1-mouse T lymphocyte/lymphoblast ,T-cell lymphoma cell line http://www.lgcstandards-atcc.org/products/all/CRL-2396 9 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G in vitro In vitro physical association physical association 2B havcr2-lgals9-2 1 11 unspecified role unspecified role unspecified role unspecified role regions_present_in_isoform2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G colocalization colocalization 3 havcr2-lgals1-1 1 9 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G 4 unspecified role unspecified role unspecified role unspecified role colocalization colocalization 3C weak interaction havcr2-lgals3-1 1 9 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G 6 unspecified role unspecified role unspecified role unspecified role colocalization colocalization 3Ci weak interaction havcr2-lgals3-2 1 9 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G 7 unspecified role unspecified role unspecified role unspecified role colocalization colocalization 3Cii weak interaction havcr2-lgals9-3 3 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G in vitro In vitro direct interaction direct interaction 4A havcr2-lgals9-4 3 8 inhibitor inhibitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G in vitro In vitro physical association physical association 4A havcr2-lgals9-5 1 8 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role unspecified role unspecified role c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G 10 unspecified role unspecified role unspecified role unspecified role colocalization colocalization 4B havcr2-lgals9-6 1 9 unspecified role unspecified role unspecified role unspecified role signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G 10 unspecified role unspecified role unspecified role unspecified role O08573-2:p.Arg64Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:11:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg64ala' Tue Jun 30 16:35:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg64Ala' O08573-2:p.Arg238Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:20:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg238ala' Tue Jun 30 16:10:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg238Ala' O08573-2:p.[Arg64Ala;Arg238Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:05:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg64ala,arg238ala' Tue Jun 30 16:56:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg64Ala;Arg238Ala]' colocalization colocalization 4C havcr2-lgals9-7 3 5 inhibitor inhibitor prey prey elime Elizabethkingia meningoseptica 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal+igV+cytoplasmic_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain trp217gly variant variant certain certain sequence position certain certain certain sequence position certain W G in vitro In vitro physical association physical association 4D