IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Temporal associations between interleukin 22 and the extracellular domains of IL-22R and IL-10R2. Temporal associations between interleukin 22 and the extracellular domains of IL-22R and IL-10R2. International immunopharmacology 2004 imex curation Li J., Tomkinson KN., Tan XY., Wu P., Yan G., Spaulding V., Deng B., Annis-Freeman B., Heveron K., Zollner R., De Zutter G., Wright JF., Crawford TK., Liu W., Jacobs KA., Wolfman NM., Ling V., Pittman DD., Veldman GM., Fouser LA. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection ec50 ng/ml 20 6 <3 Li J., Tomkinson KN., Tan XY., Wu P., Yan G., Spaulding V., Deng B., Annis-Freeman B., Heveron K., Zollner R., De Zutter G., Wright JF., Crawford TK., Liu W., Jacobs KA., Wolfman NM., Ling V., Pittman DD., Veldman GM., Fouser LA. IBD - Inflammatory bowel disease Accepted 2015-OCT-26 AT 11:41 GMT AT 11:41 GMT by MGT International immunopharmacology 2004 Only protein-protein interactions imex curation imex curation i22r1_human Interleukin-22 receptor subunit alpha-1 IL22RA1 IL22R Cytokine receptor class-II member 9 Cytokine receptor family 2 member 9 ZcytoR11 protein protein human Homo sapiens Human MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES DIP protein Q8N6P7 original sequence version: 54 DIP protein Q8N6P7 original sequence version: 74 D46CC71D496F3420 i10r2_human Interleukin-10 receptor subunit beta IL10RB CRFB4 D21S58 D21S66 Cytokine receptor class-II member 4 Cytokine receptor family 2 member 4 Interleukin-10 receptor subunit 2 protein protein human Homo sapiens Human MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS DIP protein Q08334 original sequence version: 95 E470726619AF54C2 q969j5-1 Interleukin-22 receptor subunit alpha-2 IL22RA2 Cytokine receptor class-II member 10 Cytokine receptor family 2 member 10 Cytokine receptor family type 2, soluble 1 Interleukin-22-binding protein ZcytoR16 UNQ5793/PRO19598/PRO19822 CRF2-10L CRF2-s1-long Long protein protein human Homo sapiens Human MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP C96ECEC5D78AC79B q9gzx6-pro_0000015383 Interleukin-22 Cytokine Zcyto18 IL-10-related T-cell-derived-inducible factor IL22 ILTIF ZCYTO18 UNQ3099/PRO10096 protein protein human Homo sapiens Human APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI 34 179 166C44F9B1C26BBB il22r-il22-1 1 5 unspecified role unspecified role bait bait region IL22Ra1ecd sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il22r1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey n-terminus il22 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region iL22-biot biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus il22hu flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 2 Fig. 1A, Fig. 3A and 3B (black square), Fig 4A (black triangle) Fig. 4B (solid line), Fig. 5B (black circle, black triangle), Fig6. A (broken line) il22r-il22-2 1 8 unspecified role unspecified role bait bait n-terminus il22bio his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region il22 biot biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus il22hu flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role prey prey region il22r-ecd-fc fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region il22r-ecd-fc sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 3 Fig. 1B il22r-il22-3 1 6 unspecified role unspecified role prey prey region il10r sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role bait bait region il22r sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il22r1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 2B (black triangle) Condition media (CM) from CHO cells co-expressing heterodimers IL22R and Il10R2 gave a positive signal. Signal was not positive from CM from CHO cells secreting IL-22R-Fc, IL-10R2-Fc or when CM from both was mixed together. il22r-il22-4 1 8 unspecified role unspecified role unspecified role unspecified role n-terminus il22bio his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region il22bio biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role unspecified role unspecified role region il10r2 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il10r2 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role unspecified role unspecified role region il22r1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region il22r sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 4 Fig.3A (black triangle curve), Fig. 3B (black and white triangle), Fig. 5C (black triangle) Fig. 6B (broken line) Fig. 3A, Fig 3B: Positive results were observed with Immobilized Fc-receptor from CM of CHO cells expressing IL22R or co-expressing IL-22R-Fc and IL-10R2-Fc, but not from CM of cells expressing IL10R-fc. il22r-il22-5 1 8 unspecified role unspecified role prey prey region Il22bio biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus il22bio his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus il22hu flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role bait bait region il22r1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region IL22Ra1ecd sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role bait bait region il10r2 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Il10RECD sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 5C il22r-il22-6 1 7 inhibitor inhibitor prey prey region Il22bp fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Il22bp sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role bait bait region il22r1 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il22r1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 6A (white square) il22r-il22-7 1 7 inhibitor inhibitor prey prey region il22ra2 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region il22bp sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey region il22bio biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus il22hu flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role unspecified role unspecified role region il22ra1 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il22ra1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role unspecified role unspecified role region il10r2 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il10r2 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 6B (white square) il22r-il22-8 1 7 unspecified role unspecified role bait bait region il22ra2 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 6C il22r-il22-9 1 8 unspecified role unspecified role prey prey n-terminus il22bio his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region il22bio biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 stimulator stimulator prey prey region il10r2 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region il10r2 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role bait bait region il22r1 fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region il22r sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig.4A (black diamond), Fig. 4B (black circle) A dose dependent positive signal was observed when IL-10R2-Fc was added with bio-IL-22 to immobilized IL-22R-Fc.