IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 imex curation Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org Accepted 2015-FEB-04 by ORCHARD Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 Only protein-protein interactions imex curation STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 imex curation Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Cells were stimulated with a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) prior to the binding assay. The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org Accepted 2015-FEB-04 by ORCHARD Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 Only protein-protein interactions imex curation STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 imex curation Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Cells were stimulated with a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) prior to the binding assay. The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org Accepted 2015-FEB-04 by ORCHARD Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 Only protein-protein interactions imex curation STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 imex curation Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Cells were stimulated with a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) prior to the binding assay. The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org Accepted 2015-FEB-04 by ORCHARD Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 Only protein-protein interactions imex curation STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation. Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 imex curation Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu W., Comhair S.A., Zheng S., Chu S.C., Marks-Konczalik J., Moss J., Haque S.J., Erzurum S.C. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The HA-tagged human STAT1 expression construct is described in PMID:8940092. erzurus@ccf.org Accepted 2015-FEB-04 by ORCHARD Am. J. Physiol. Lung Cell Mol. Physiol. (1040-0605) 2003 Only protein-protein interactions imex curation jund_human Transcription factor jun-D JUND protein protein human Homo sapiens Human METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY DIP protein P17535 original sequence version: 147 DIP protein P17535 original sequence version: 119 FE85A1AA2B5B9597 nos2_human_gas_dna-probe Human NOS2 gene promoter gamma-activated site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CGGGCGTTTCCAGTAAAAATC nos2_human_ap1u/gas-site_dna-probe Human NOS2 gene promoter activator protein 1 upstream and gamma-activated site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GCCAGCTTGAGTCACACTCCAGACCACCGGGCGTTTCCAGTAAAAATC jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 stat1_human Signal transducer and activator of transcription 1-alpha/beta STAT1 Transcription factor ISGF-3 components p91/p84 protein protein human Homo sapiens Human MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV 054A813522364BA6 nos2_human_ap1u-site_dna-probe Human NOS2 gene promoter activator protein 1 upstream site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GCCAGCTTGAGTCACACTCCA fosl2_human Fos-related antigen 2 FOSL2 FRA2 protein protein human Homo sapiens Human MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL DIP protein P15408 original sequence version: 99 DIP protein P15408 original sequence version: 123 nos2_human_ap1d-site_dna-probe Human NOS2 gene promoter activator protein 1 downstream site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human ATTTGTGTGACTCACGCCCTC fos-stat1-1 5 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Fig. 9a, 9b human interferon gamma (IFNgamma) (P01579) cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) An IFN-gamma dose of 100 U/ml was necessary to detect STAT1 coimmunoprecipitation with c-Fos. fos-stat1-2 4 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait naturally occurring naturally occurring endogenous endogenous physical association physical association Fig. 9c fos-stat1-3 3 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 9c fos-stat1-4 2 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Fig. 9d stat1-fos 2 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 9d nos2-fos 1 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium physical association physical association Fig. 5 human interferon gamma (IFNgamma) (P01579) P01579 indirectly increases expression at RNA level of ENSG00000007171 P01579 indirectly increases expression at protein level of ENSG00000007171 nos2-jun 1 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium physical association physical association Fig. 5 human interferon gamma (IFNgamma) (P01579) nos2-stat1 1 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium physical association physical association Fig. 5 human interferon gamma (IFNgamma) (P01579) nos2-stat1-1 1 11 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 5, 6a, 6b human interferon gamma (IFNgamma) (P01579) Binding was also detected using cell extracts from cells stimulated with a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375). nos2-fos-1 1 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium physical association physical association Fig. 5, 6a, 6b human interferon gamma (IFNgamma) (P01579) Binding was also detected using cell extracts from cells stimulated with a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375). nos2-fos-2 1 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma physical association physical association Fig. 7a, 7c cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) P01100 increases expression at RNA level of ENSG00000007171 P01579 and P01584 and P01375 indirectly increases expression at RNA level of ENSG00000007171 P01579 and P01584 and P01375 indirectly increases expression at protein level of ENSG00000007171 nos2-fosl2 1 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma physical association physical association Fig. 7a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) nos2-jun-1 1 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma physical association physical association Fig. 7a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) nos2-jund 1 6 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 7a cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) nos2-fos-1 1 10 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 7b nos2-jun-1 1 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role prey prey human-bronchial_epithelial Homo sapiens bronchial_epithelium bronchial epithelium physical association physical association Fig. 7b nos2-fos-1 1 10 unspecified role unspecified role prey prey human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma 14 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 7c cytokine mixture containing human interferon gamma (IFNgamma) (P01579), interleukin-1 beta (IL-1beta) (P01584) and tumor necrosis factor alpha (TNF-alpha) (P01375) The interaction of c-Fos with the oligonucleotide probe containing the downstream AP-1 binding site of the human NOS2 gene promoter was much weaker compared to the interaction with the probe containing the upstream AP-1 binding site.