MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov J. Biol. Chem. (0021-9258) 2003 imex curation p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins no lance.terada@med.va.gov J. Biol. Chem. (0021-9258) 2003 imex curation p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins no lance.terada@med.va.gov J. Biol. Chem. (0021-9258) 2003 imex curation p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions baker's yeast-ah 109 Saccharomyces cerevisiae ah 109 ah 109 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov human endothelial (HUVEC) lambda phage Gal4-AD library J. Biol. Chem. (0021-9258) 2003 imex curation p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease lance.terada@med.va.gov J. Biol. Chem. (0021-9258) 2003 imex curation p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins no lance.terada@med.va.gov J. Biol. Chem. (0021-9258) 2003 imex curation p47phox participates in activation of RelA in endothelial cells. p47phox participates in activation of RelA in endothelial cells. J. Biol. Chem. (0021-9258) 2003 imex curation Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins lance.terada@med.va.gov Only protein-protein interactions human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gu Y., Xu YC., Wu RF., Nwariaku FE., Souza RF., Flores SC., Terada LS. IBD - Inflammatory bowel disease Virus - Publications including interactions involving viral proteins no lance.terada@med.va.gov J. Biol. Chem. (0021-9258) 2003 imex curation ncf1_human Neutrophil cytosol factor 1 NCF1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K 47 kDa autosomal chronic granulomatous disease protein Nox-organizing protein 2 Nox organizer 2 SH3 and PX domain-containing protein 1A NOXO2 SH3PXD1A protein protein human Homo sapiens Human MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV 3D91EDC99A1B6417 p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A tnfa_mouse_kb3-site_dna-probe Mouse TNFA promoter kb3 site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse AAACAGGGGGCTTTCCCTCCTC tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 ncf1-rela 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed sh3_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Fig. 1a No binding with Full lenght p47 homomint mint ncf1-rela-1 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association Fig. 1c homomint mint ncf1-rela-2 3 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence autoradiography autoradiography unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence autoradiography autoradiography unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 direct interaction direct interaction Fig. 1b No binding with Full lenght p47 homomint mint P14598 increases activity of Q04206 ncf1-rela-3 3 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence autoradiography autoradiography unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence autoradiography autoradiography unspecified role unspecified role bait bait purified purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 28 31 direct interaction direct interaction Fig. 4a homomint mint ncf1-rela-4 6 11 immunocytochemistry immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 8 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization Fig. 5 BIOSOURCE= human HUVEC cells homomint mint rela-ncf1 7 11 unspecified role unspecified role bait bait Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association Fig. 1d BIOSOURCE=human HUVEC cells homomint mint ncf1-rela-5 3 11 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 4c ncf1-rela-6 4 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1a tnfa-rela 5 10 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role prey prey human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] physical association physical association Fig. 3a tnfa-nfkb1 5 9 unspecified role unspecified role prey prey human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 10 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3a