IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease Fig. 7D c-myc participant is not Swiss Prot reviewed therefore interaction with IL23R was not curated. kevin.moore@dnax.org Accepted 2015-NOV-26 AT 08:36 GMT AT 08:36 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation I tried reading the sections for interactions that involve PTM, but I did not succeed to curate it. I know will be gest and faster to learn this with you. I will see you about this. .; For both EMSA expt results on gel picture are a bit confusing for me. I would like to understand the experiment and conclusions for their results as that is what I curated. I will ask you when we go over the PMT curation. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org Accepted 2015-NOV-26 AT 08:36 GMT AT 08:36 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation I tried reading the sections for interactions that involve PTM, but I did not succeed to curate it. I know will be gest and faster to learn this with you. I will see you about this. .; For both EMSA expt results on gel picture are a bit confusing for me. I would like to understand the experiment and conclusions for their results as that is what I curated. I will ask you when we go over the PMT curation. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org Accepted 2015-NOV-26 AT 08:36 GMT AT 08:36 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation I tried reading the sections for interactions that involve PTM, but I did not succeed to curate it. I know will be gest and faster to learn this with you. I will see you about this. .; For both EMSA expt results on gel picture are a bit confusing for me. I would like to understand the experiment and conclusions for their results as that is what I curated. I will ask you when we go over the PMT curation. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-kit 225 Homo sapiens kit 225 kit 225 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org Accepted 2015-NOV-26 AT 08:36 GMT AT 08:36 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation I tried reading the sections for interactions that involve PTM, but I did not succeed to curate it. I know will be gest and faster to learn this with you. I will see you about this. .; For both EMSA expt results on gel picture are a bit confusing for me. I would like to understand the experiment and conclusions for their results as that is what I curated. I will ask you when we go over the PMT curation. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-kit 225 Homo sapiens kit 225 kit 225 emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org Accepted 2015-NOV-26 AT 08:36 GMT AT 08:36 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation I tried reading the sections for interactions that involve PTM, but I did not succeed to curate it. I know will be gest and faster to learn this with you. I will see you about this. .; For both EMSA expt results on gel picture are a bit confusing for me. I would like to understand the experiment and conclusions for their results as that is what I curated. I will ask you when we go over the PMT curation. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J., Pflanz S., Zhang R., Singh KP., Vega F., To W., Wagner J., O'Farrell AM., McClanahan T., Zurawski S., Hannum C., Gorman D., Rennick DM., Kastelein RA., de Waal Malefyt R., Moore KW. IBD - Inflammatory bowel disease kevin.moore@dnax.org Accepted 2015-NOV-26 AT 08:36 GMT AT 08:36 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2002 imex curation I tried reading the sections for interactions that involve PTM, but I did not succeed to curate it. I know will be gest and faster to learn this with you. I will see you about this. .; For both EMSA expt results on gel picture are a bit confusing for me. I would like to understand the experiment and conclusions for their results as that is what I curated. I will ask you when we go over the PMT curation. stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D jak2_mouse Tyrosine-protein kinase JAK2 Janus kinase 2 Jak2 protein protein mouse Mus musculus Mouse MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHDILYRIRFYFPHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDVQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLKEALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKRNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVQISPTLQRHNNVNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHKTEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWAMHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTELANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIELLKSNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSIAA DIP protein Q62120 original sequence version: 149 DIP protein Q62120 original sequence version: 109 DIP protein Q62120 original sequence version: 117 DIP protein Q62120 original sequence version: 110 7BA35989B880D0A6 stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P42227 original sequence version: 169 DIP protein P42227 original sequence version: 162 DIP protein P42227 original sequence version: 164 DIP protein P42227 original sequence version: 141 6C00626711C8012D stat1_human Signal transducer and activator of transcription 1-alpha/beta STAT1 Transcription factor ISGF-3 components p91/p84 protein protein human Homo sapiens Human MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV 054A813522364BA6 il12b_human Interleukin-12 subunit beta IL12B NKSF2 IL-12 subunit p40 Cytotoxic lymphocyte maturation factor 40 kDa subunit NK cell stimulatory factor chain 2 protein protein human Homo sapiens Human MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS 118FA801B8F5BB2F stat_probe M67_SIE dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CATTTCCCGTAAATC stat4_human Signal transducer and activator of transcription 4 STAT4 protein protein human Homo sapiens Human MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHMLERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE DIP protein Q14765 original sequence version: 81 11E43803A9AF4FFA il23r_human Interleukin-23 receptor IL23R protein protein human Homo sapiens Human MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGMIVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMNNNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDLNTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLEK AC63C89E81AABF05 i12r1_human Interleukin-12 receptor subunit beta-1 IL12RB1 IL12R IL12RB IL-12 receptor beta component protein protein human Homo sapiens Human MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKAKM 541ADA60F62DA1EF il23a_human Interleukin-23 subunit alpha IL23A SGRF Interleukin-23 subunit p19 UNQ2498/PRO5798 protein protein human Homo sapiens Human MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP 51B5C0F188EC1B9F il23a-il23r-1 2 16 unspecified role unspecified role prey prey n terminus IL23 flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 14 unspecified role unspecified role bait bait region IL23RIg fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig 4B Q9NPF7 activates Q5VWK5 p19-p40-il23r-1 3 11 unspecified role unspecified role bait bait region IL12-p19 flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region IL23alpha-p40 flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 14 unspecified role unspecified role prey prey region hIl23R-his6 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind range range range range c-c v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 27 25 association association Fig. 4C stat_probe-stat4-1 5 12 unspecified role unspecified role bait bait radiolabel STAT 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Fig. 7A lanes 2 and 3 IL-12 (P29460) stat_probe_stat3-1 5 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region Stat_probe 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 7A, lanes 4,6,7,9 IL-23 (Q9NPF7) stat_probe-stat3-4-2 5 12 unspecified role unspecified role bait bait radiolabel STAT 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 7A lanes 4,7 IL23 (Q9NPF7) stat_probe-stat1-1 5 12 unspecified role unspecified role bait bait radiolabel STAT 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey physical association physical association Fig. 7A, lanes 4,8,9,10 IL23 (Q9NPF7) stat_probe-stat3-1 6 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region Stat_probe 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 7B, lanes 4,6,8 IL23 (Q9NPF7) is an agonist for STAT3 activation. stat_probe-stat3-3 6 12 unspecified role unspecified role bait bait radiolabel STAT 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 7B lanes 4,8 IL23 (Q9NPF7) is an agonist stat_probe-stat4-2 6 12 unspecified role unspecified role bait bait radiolabel STAT 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Fig. 7B lanes 2,3 IL12 is agonist for STAT4 activation. stat_probe-stat4-3 6 12 unspecified role unspecified role bait bait radiolabel STAT 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Fig. 7B lanes 4,7,8 IL23 (Q9NPF7) is an agonist il12rb1-1 4 16 unspecified role unspecified role unspecified role unspecified role agonist 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Fig. 7C lane 6 IL-23 (Q9NPF7) is agonist of IL12B (P29460) activation il23r-jak2-2 1 14 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association Fig. 7D lanes 3 and 4 il23r-stat3-1 1 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey association association Fig. 7D lane 4 IL-23