UniProt UniProt http://www.uniprot.org ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease iPS cells from a HD patient (carrying 41 CAG repeats) were differentiated into neurons prior to affinity purification of the complex xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-STHdhq111/q111 immortalised embryonic striatal cells with humanised HTT Exon 1 and 111 CAG repeats sthdhq111 STHdh Q111/Q111 https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00095&PgId=166 Coriell Cell Repositories;CH00095 Cellosaurus STHdhQ111 (CVCL_M591) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease Crosslinking agent - DSP (dithiobis(succinimidyl propionate)) or formaldehyde xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-brain-cortex Homo sapiens brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-brain-caudate_nucleus Human brain, caudate nuclear region brain-caudate_nucleus caudate nucleus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-STHdhq111/q111 immortalised embryonic striatal cells with humanised HTT Exon 1 and 111 CAG repeats sthdhq111 STHdh Q111/Q111 https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00095&PgId=166 Coriell Cell Repositories;CH00095 Cellosaurus STHdhQ111 (CVCL_M591) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-STHdhQ7/Q7 mouse STHdhQ7/Q7 sthdhq7/q7 STHdhQ7/Q7 mouse (brain)- striatal derived cell line from a knock in transgenic mouse containing homozygous Huntingtin (HTT) loci with a humanized Exon 1 containing 7 polyglutamine repeats. CVCL_M590 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease Crosslinking agent - DSP (dithiobis(succinimidyl propionate)) xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-striatum Mus musculus, striatum striatum striatum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease R6/2 mice which are transgenic for the 5-prime end of the human HD gene carrying 100–150 glutamine (CAG) repeats. xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-striatum Mus musculus, striatum striatum striatum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-ips Human- induced pluripotent stem cells ips cells Induced pluripotent stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease iPS cells from a HD patient (carrying 41 CAG repeats) were differentiated into neurons prior to affinity purification of the complex xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nature communications 2014 imex curation Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-STHdhQ7/Q7 mouse STHdhQ7/Q7 sthdhq7/q7 STHdhQ7/Q7 mouse (brain)- striatal derived cell line from a knock in transgenic mouse containing homozygous Huntingtin (HTT) loci with a humanized Exon 1 containing 7 polyglutamine repeats. CVCL_M590 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Accepted 2020-FEB-28 AT 09:18 GMT AT 09:18 GMT by PPORRAS Nature communications 2014 Only protein-protein interactions imex curation imex curation hs71l_human Heat shock 70 kDa protein 1-like HSPA1L Heat shock 70 kDa protein 1-Hom protein protein human Homo sapiens Human MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD A9339D7657166FF7 fis1_mouse Mitochondrial fission 1 protein Fis1 Ttc11 FIS1 homolog Tetratricopeptide repeat protein 11 protein protein mouse Mus musculus Mouse MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission mint B012DF491518A4B1 atp5h_human ATP synthase subunit d, mitochondrial ATP5PD ATP synthase peripheral stalk subunit d ATP5H My032 protein protein human Homo sapiens Human MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL E93020ADA1BA1694 mid51_mouse Mitochondrial dynamics protein MID51 Mief1 Mid51 Smcr7l Mitochondrial dynamics protein of 51 kDa homolog Mitochondrial elongation factor 1 Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like protein protein mouse Mus musculus Mouse MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNKDMKAGLSRSLQTLPTDSSAFDTDTFCPPRPKPLARRGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT DIP protein Q8BGV8 original sequence version: 73 qcr2_human Cytochrome b-c1 complex subunit 2, mitochondrial Ubiquinol-cytochrome-c reductase complex core protein 2 Core protein II Complex III subunit 2 UQCRC2 protein protein human Homo sapiens Human MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL BFA655C24C07AF52 atad3_mouse ATPase family AAA domain-containing protein 3 AAA-ATPase TOB3 Atad3 Atad3a Kiaa1273 protein protein mouse Mus musculus Mouse MSWLFGIKGPKGEGTGPPLPLPPAQPGAEGGGDRGAGDRPSPKDKWSNFDPTGLERAAKAARELEHSRHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELRHKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPIQVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREERERLVRMYFDKYVLKPATEGKQRLKVAQFDYGKKCSEVAQLTEGMSGREIAQLAVAWQAMAYSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERPDSQTNKPPHPSLLSC DIP protein Q925I1 original sequence version: 76 DIP protein Q925I1 original sequence version: 79 66B599114B94620E adt2_human ADP/ATP translocase 2 SLC25A5 ANT2 Adenine nucleotide translocator 2 ADP,ATP carrier protein 2 Solute carrier family 25 member 5 ADP,ATP carrier protein, fibroblast isoform AAC2 protein protein human Homo sapiens Human MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT DIP protein P05141 original sequence version: 132 DC53D083E7217AFE bckd_human [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial Branched-chain alpha-ketoacid dehydrogenase kinase BCKDK protein protein human Homo sapiens Human MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI AC97CF5D151FEFB4 kpym_human Pyruvate kinase PKM PKM Cytosolic thyroid hormone-binding protein OIP3 Opa-interacting protein 3 PK2 PK3 PKM2 Pyruvate kinase 2/3 Pyruvate kinase muscle isozyme Thyroid hormone-binding protein 1 Tumor M2-PK p58 protein protein human Homo sapiens Human MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP DIP protein P14618 original sequence version: 162 AA94D7818ED6BBAD echb_human Trifunctional enzyme subunit beta, mitochondrial HADHB MSTP029 TP-beta protein protein human Homo sapiens Human MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK DIP protein P55084 original sequence version: null A7B41C37BEC1E6AD mff_mouse Mitochondrial fission factor Mff protein protein mouse Mus musculus Mouse MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQEFQDGVPNASVIMQVPERIVVTGNNEDISFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPLPTPQSEESRAVGRLKRERSMSENAVRQNGQLVRNDSIVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNLDAAIEGASDDMTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR 658884A1EF8EBCFD grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ DIP protein P38646 original sequence version: 188 90969A8D06757753 ptcd3_human Pentatricopeptide repeat domain-containing protein 3, mitochondrial Transformation-related gene 15 protein TRG15 28S ribosomal protein S39, mitochondrial MRPS39 PTCD3 Mitochondrial small ribosomal subunit protein mS39 protein protein human Homo sapiens Human MAVVSAVRWLGLRSRLGQPLTGRRAGLCEQARSCRFYSGSATLSKVEGTDVTGIEEVVIPKKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYLMPASSLESRSFLLAKKSGENVAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIKDISEAALKERIELRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCYYGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHADVYTFNALIEATVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFARSPALQVLREMKAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTALTSDSDTDSSSDSDSDTSEGK 901DBE1FF3A2E0B9 bcl7c_human B-cell CLL/lymphoma 7 protein family member C BCL7C protein protein human Homo sapiens Human MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP mint homomint May play an anti-apoptotic role 379CDFFF250195A5 dnm1l_mouse Dynamin-1-like protein Dnm1l Drp1 Dynamin-related protein 1 Dynamin family member proline-rich carboxyl-terminal domain less protein protein mouse Mus musculus Mouse MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKSSKVPSALAPASQEPPPAASAEADGKLIQDNRRETKNVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW 5A8679B61A444847 mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E atpg_human ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 ATP5CL1 F-ATPase gamma subunit protein protein human Homo sapiens Human MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD 021A95168FD53E04 odo2_human Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial DLST DLTS Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex E2K 2-oxoglutarate dehydrogenase complex component E2 protein protein human Homo sapiens Human MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL A30E8CC959106B8F dnja3_human DnaJ homolog subfamily A member 3, mitochondrial DNAJA3 TID1 HCA57 Tumorous imaginal discs protein Tid56 homolog DnaJ protein Tid-1 Hepatocellular carcinoma-associated antigen 57 protein protein human Homo sapiens Human MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS DIP protein Q96EY1 original sequence version: 121 5A57B9020992CF59 q9nvi7-2 ATPase family AAA domain-containing protein 3A ATAD3A protein protein human Homo sapiens Human MSWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYAKDALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLKAEGPGRGDEPSPS May be the predominant ATAD3A form. Variant in position: 53:T->I (in HAYOS) (Ref.19). Variant in position: 528:R->W (in HAYOS) (Ref.19). 1E83D08AE33D550F at5f1_human ATP synthase F(0) complex subunit B1, mitochondrial ATP5PB ATP synthase peripheral stalk-membrane subunit b ATP synthase proton-transporting mitochondrial F(0) complex subunit B1 ATP synthase subunit b ATP5F1 protein protein human Homo sapiens Human MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM 743B1C54BFFEBBBD hspa1a_hspa1b_human-1 HSPA1A_HSPA1B_human molecule set molecule set human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD P0DMV8,P0DMV9 tfam_human Transcription factor A, mitochondrial TCF6 Mitochondrial transcription factor 1 Transcription factor 6-like 2 TFAM TCF6L2 Transcription factor 6 protein protein human Homo sapiens Human MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC 81F00CFA12DA4924 kcru_human Creatine kinase U-type, mitochondrial Ubiquitous mitochondrial creatine kinase Acidic-type mitochondrial creatine kinase CKMT1A CKMT CKMT1B protein protein human Homo sapiens Human MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH 274DAC2E9A8AD882 hsp72_human Heat shock-related 70 kDa protein 2 HSPA2 protein protein human Homo sapiens Human MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD 3851755494E7B729 c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B atd3a_human ATPase family AAA domain-containing protein 3A ATAD3A protein protein human Homo sapiens Human MSWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYAKDALNLAQMQEQTLQLEQQSKLKMRLEALSLLHTLVWAWSLCRAGAVQTQERLSGSASPEQVPAGECCALQEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLKAEGPGRGDEPSPS DIP protein Q9NVI7 original sequence version: 90 47E765629B6F3267 atp5l_human ATP synthase subunit g, mitochondrial ATP5MG ATP synthase membrane subunit g ATP5L protein protein human Homo sapiens Human MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 03D484BCF836E6C2 odb2_human Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial DBT BCATE2 Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase Dihydrolipoamide branched chain transacylase Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex Branched-chain alpha-keto acid dehydrogenase complex component E2 52 kDa mitochondrial autoantigen of primary biliary cirrhosis Branched chain 2-oxo-acid dehydrogenase complex component E2 protein protein human Homo sapiens Human MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK A7CA728C8F33D126 rpab1_human DNA-directed RNA polymerases I, II, and III subunit RPABC1 POLR2E DNA-directed RNA polymerase II subunit E RPB5 homolog DNA-directed RNA polymerase II 23 kDa polypeptide XAP4 protein protein human Homo sapiens Human MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ DIP protein P19388 original sequence version: 112 DIP protein P19388 original sequence version: 175 1E88AFDBCF9C8535 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 atpk_human ATP synthase subunit f, mitochondrial ATP5MF ATP synthase membrane subunit f ATP5J2 ATP5JL protein protein human Homo sapiens Human MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH D5F0D94273DEF880 prdx3_human Thioredoxin-dependent peroxide reductase, mitochondrial Peroxiredoxin-3 Peroxiredoxin III Antioxidant protein 1 Protein MER5 homolog HBC189 PRDX3 AOP1 Thioredoxin-dependent peroxiredoxin 3 protein protein human Homo sapiens Human MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ DIP protein P30048 original sequence version: 182 8BEB7F5E55BFE9BE vdac2_human Voltage-dependent anion-selective channel protein 2 VDAC2 Outer mitochondrial membrane protein porin 2 protein protein human Homo sapiens Human MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA F4EAE732E653637E dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 F9521A376B785B71 dnm1l-10 16 31 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 44 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 50 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 51 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 24 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 33 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 41 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 48 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 46 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 25 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 35 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 42 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 39 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 29 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 49 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 45 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 34 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 38 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 27 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 43 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 40 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 36 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 47 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 30 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 52 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Table 1 atad3-dnm1l-1 17 23 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Immunoprecipitation (IP) analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 cells than in HdhQ7 cells Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-1 17 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Immunoprecipitation (IP) analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 cells than in HdhQ7 cells Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C atad3-dnm1l-2 11 23 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Immunoprecipitation (IP) analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 cells than in HdhQ7 cells Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-2 11 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Immunoprecipitation (IP) analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 cells than in HdhQ7 cells Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-3 15 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3-nitropropionic acid (CHEBI:16348) Fig. 1D dnm1l-atad3-4 6 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association ATAD3A preferentially bound to Drp1 in striatal protein lysates of HD YAC128, which exhibit chronic HD-like neurodegeneration with a year-long disease development, and R6/2 mice relative to those of wild-type mice. YAC128 mice contain a full-length human huntingtin gene modified with a 128 CAG repeat expansion in exon 1. R6/2 mice are transgenic for the 5-prime end of the human HD gene carrying 100–150 glutamine (CAG) repeats. Fig. 1E dnm1l-atad3-5 7 44 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 52 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fibroblasts from human patients Fig. 1F, Supp Fig. 1C dnm1l-atad3a-1 5 44 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 52 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Brain samples from human patients Supp. 1D dnm1l-atad3a-2 3 37 unspecified role unspecified role prey prey purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 52 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction In vitro protein binding assay showed that GST-Drp1 and ATAD3A-Flag protein interacted (Fig. 1h). Fig. 1H, 5E atad3a-dnm1l-1 10 44 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 52 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Brain samples from human patients Fig. 1G Supp. 1E dnm1l-atad3a-3 9 37 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 52 unspecified role unspecified role prey prey purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction In vitro protein binding assay showed that GST-Drp1 and ATAD3A-Flag protein interacted (Fig. 1h). Fig. 1H atad3a-1 1 37 unspecified role unspecified role neutral component neutral component purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NVI7-2:p.Lys135Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K Q Tue Jun 30 17:56:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Gln' Q9NVI7-2:p.Lys135Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 16:57:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Glu' Q9NVI7-2:p.Lys135Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 19:06:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Arg' Q9NVI7-2:p.Lys135Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:59:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Fig. 4C Beta-mercaptoethanol (CHEBI:41218) atad3a-atad3a-1 4 37 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NVI7-2:p.Lys135Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K Q Tue Jun 30 16:03:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Gln' Q9NVI7-2:p.Lys135Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K Q Wed Sep 18 13:37:11 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Glu' Tue Jun 30 18:51:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Gln' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4D, Supp. Fig. 2G dnm1l-atad3a-4 12 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9NVI7-2:p.Lys135Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 19:12:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Arg' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NVI7-2:p.Lys135Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K Q Tue Jun 30 16:52:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Gln' Q9NVI7-2:p.Lys135Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 17:34:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Glu' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 52 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4E, Supp Fig. 1G dnm1l-atad3-6 11 32 competitor competitor competitor prey prey protein delivery protein delivery region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Immunoprecipitation (IP) analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 cells than in HdhQ7 cells Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C, 5D, Supp. 7A dnm1l-atad3-7 14 32 competitor competitor competitor prey prey protein delivery protein delivery region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Peptide inhibition observed in R6/2 mice which are transgenic for the 5-prime end of the human HD gene carrying 100–150 glutamine (CAG) repeats. Fig. 5D dnm1l-atad3a-5 3 52 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 37 unspecified role unspecified role prey prey purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 52 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction In vitro protein binding assay showed that GST-Drp1 and ATAD3A-Flag protein interacted (Fig. 1h). Fig. 5E dnm1l-atad3a-6 8 32 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level mouse-STHdhQ7/Q7 mouse STHdhQ7/Q7 sthdhq7/q7 STHdhQ7/Q7 mouse (brain)- striatal derived cell line from a knock in transgenic mouse containing homozygous Huntingtin (HTT) loci with a humanized Exon 1 containing 7 polyglutamine repeats. CVCL_M590 direct interaction direct interaction In vitro protein binding assay showed that GST-Drp1 and ATAD3A-Flag protein interacted (Fig. 1h). Fig. 5F dnm1l-atad3-8 8 32 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-STHdhq111/q111 immortalised embryonic striatal cells with humanised HTT Exon 1 and 111 CAG repeats sthdhq111 STHdh Q111/Q111 https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00095&PgId=166 Coriell Cell Repositories;CH00095 Cellosaurus STHdhQ111 (CVCL_M591) direct interaction direct interaction In vitro protein binding assay showed that GST-Drp1 and ATAD3A-Flag protein interacted (Fig. 1h). Fig. 5F dnm1l-atad3a-7 4 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NVI7-2:p.Lys135Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K Q Tue Jun 30 15:36:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Gln' Q9NVI7-2:p.Lys135Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 20:18:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys135Glu' 52 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp. Figs. 1G, 6E dnm1l-atad3-9 15 32 competitor competitor competitor prey prey protein delivery protein delivery region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3-nitropropionic acid (CHEBI:16348) Fig. 1D, Supp. Fig. 7B dnm1l-mff-1 13 28 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. Fig. 7D dnm1l-mff-2 2 28 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. Fig. 7D fis1-dnm1l-1 2 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. Fig. 7D mief1-dnm1l-3 2 21 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. Fig. 7D mief1-dnm1l-4 13 21 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. Fig. 7D dnm1l-atad3-10 8 32 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction In vitro protein binding assay showed that GST-Drp1 and ATAD3A-Flag protein interacted (Fig. 1h). Supp. Fig. 7E dnm1l-atad3-11 17 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp Fig. 7A