IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Additional detail on constructs obtained from the author. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Additional detail on constructs obtained from the author. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntingtin protein assumed to be human due to reference to Choi-2013 publication entitled "Autophagy in human health and disease." pmid:23406030. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family. Cell (0092-8674) 2014 imex curation Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease jentsch@biochem.mpg.de 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lu K., Psakhye I., Jentsch S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Additional detail on constructs obtained from the author. jentsch@biochem.mpg.de Accepted 2014-DEC-04 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation tolip_human Toll-interacting protein TOLLIP protein protein human Homo sapiens Human MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP 386E0F284D3837DA tctp_yeast Translationally-controlled tumor protein homolog MMI1 YKL056C YKL312 TMA19 Translation machinery-associated protein 19 Microtubule and mitochondria-interacting protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIIYKDIFSNDELLSDAYDAKLVDDVIYEADCAMVNVGGDNIDIGANPSAEGGDDDVEEGAEMVNNVVHSFRLQQTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKVIGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIVEEKI C4407A3B3B77124A C4407A3B3B77124A atg3_yeast Autophagy-related protein 3 Autophagy-related E2-like conjugation enzyme ATG3 ATG3 AUT1 YNR007C N2040 APG3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW 52CCFB216B18CF0C 52CCFB216B18CF0C fkbp_yeast FK506-binding protein 1 RBP1 N1213 N1845 YNL135C FPR1 FKB1 Peptidyl-prolyl cis-trans isomerase Rapamycin-binding protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN 65C134830D300C06 65C134830D300C06 rsp5_yeast E3 ubiquitin-protein ligase RSP5 RSP5 MDP1 NPI1 YER125W SYGP-ORF41 Reverses SPT-phenotype protein 5 HECT-type E3 ubiquitin transferase RSP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSSISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAKKTLNPYWNETFKFDDINENSILTIQVFDQKKFKKKDQGFLGVVNVRVGDVLGHLDEDTATSSGRPREETITRDLKKSNDGMAVSGRLIVVLSKLPSSSPHSQAPSGHTASSSTNTSSTTRTNGHSTSSTRNHSTSHPSRGTAQAVESTLQSGTTAATNTATTSHRSTNSTSSATRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTEAERGNQLNANTELERRQHRGRTLPGGSSDNSSVTVQVGGGSNIPPVNGAAAAAFAATGGTTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETIGFGQE 6F1836384479E70F 6F1836384479E70F atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 1246CEFF5A038819 atg7_yeast Ubiquitin-like modifier-activating enzyme ATG7 ATG7 APG7 CVT2 ATG12-activating enzyme E1 ATG7 Cytoplasm to vacuole targeting protein 2 Autophagy-related protein 7 YHR171W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA 561EEC94F0ED57F5 561EEC94F0ED57F5 mlp3a_human Microtubule-associated proteins 1A/1B light chain 3A Microtubule-associated protein 1 light chain 3 alpha MAP1A/MAP1B light chain 3 A MAP1 light chain 3-like protein 1 Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1LC3A protein protein human Homo sapiens Human MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF 48C1FBE8F7892AF3 sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD hd_human Huntingtin HTT IT15 HD Huntington disease protein protein protein human Homo sapiens Human MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTTC DIP protein P42858 original sequence version: 148 DIP protein P42858 original sequence version: 145 DIP protein P42858 original sequence version: 142 DIP protein P42858 original sequence version: 157 DIP protein P42858 original sequence version: 158 DIP protein P42858 original sequence version: 156 A267509E84D52F0D nbr1_human Next to BRCA1 gene 1 protein Neighbor of BRCA1 gene 1 protein Membrane component chromosome 17 surface marker 2 Protein 1A1-3B NBR1 1A13B KIAA0049 M17S2 Cell migration-inducing gene 19 protein MIG19 protein protein human Homo sapiens Human MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY 6A057E67947838EF cue5_yeast Ubiquitin-binding protein CUE5 YOR042W CUE5 Coupling of ubiquitin conjugation to ER degradation protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEEKEGIKDSSLLEKSNVPESINEDISKTTDVDLNSDGKKDNDTSAKDGTPKVEEKVNKSSGIDEDEVVTPAEDAKEEEEEHPPLPARRKSEEEPSKENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKNPEAPARRRQTQLEQDELLARQLDEQFNSSHSRRRNRDRATRSMHEQRRRRHNPNEREQHHEDSEEEDSWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDAYRRNFASGNEQNDNQHGHQDQQEWEPEIVDLSQGGKNSRPQQPERRRFNSFGVQVGDDSLESHGITLHNEDGFEDDEDVPPQLPTRTKSGESTGKVVAETTYIDTPDTETKKKWQPLPPEPLDTTPTKVNAVSRNKKNPDEDEFLINSDDEM 0D455F9AD637AC8D 0D455F9AD637AC8D atg8-cue5 5 19 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2C Starvation cue5-atg8 5 13 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lipidated residue modres protein modification ModRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2D Starvation Cue5 preferentially interacts with the lipidated form of Atg8 cue5-atg8-1 4 19 unspecified role unspecified role bait bait Q08412:p.Trp373Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:14:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp373ala' Tue Jun 30 17:22:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp373Ala' Q08412:p.Leu376Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:56:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu376ala' Tue Jun 30 17:34:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu376Ala' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q08412:p.Trp373_Leu376delinsAlaAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain WQPL AAAA Wed May 02 15:27:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_gln_pro_leu373-376ala_ala_ala_ala' Tue Jun 30 17:37:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp373_Leu376delinsAlaAlaAlaAla' ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast direct interaction direct interaction Fig. 2E atg8-atg3-1 3 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 19 unspecified role unspecified role prey prey association association Supp. Fig. 2A, 2B Starvation cue5-tma19 5 19 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role ancillary ancillary association association Fig. 4D cue5-fpr1 5 12 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 4D rsp5-cue5 5 12 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 19 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4E atg8-htt 6 17 unspecified role unspecified role prey prey gln-18_96 gln variant variant certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5D Atg8 does not bind the none-aggregation-prone Htt-20Q protein variant. cue5-htt 6 17 unspecified role unspecified role prey prey gln-18_96 gln variant variant certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q08412:p.Leu135_Leu136delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LL AA Thu Jul 07 12:18:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu135_136ala Fri Jul 22 11:14:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu135ala,leu136ala' Wed May 02 18:31:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu135-136ala_ala' Tue Jun 30 15:37:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu135_Leu136delinsAlaAla' physical association physical association Fig. 5D, 5E Cue5 does not bind the none-aggregation-prone Htt-20Q protein variant. map1lc3a-tollip-1 7 15 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey Q9H0E2:p.[Trp133_Ile136delinsAlaAlaAlaAla;Trp151_Leu154delinsAlaAlaAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain WTHI AAAA certain certain sequence position certain certain certain sequence position certain WYSL AAAA Thu Jul 07 12:17:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp133_thr134_his135_ile136_trp151_tyr152_ser153_leu154ala Fri Jul 22 11:01:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp133ala,thr134ala,his135ala,ile136ala,trp151ala,tyr152ala,ser153ala,leu154ala' Wed May 02 16:16:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_thr_his_ile133-136ala_ala_ala_ala,trp_tyr_ser_leu151-154ala_ala_ala_ala' Tue Jun 30 18:25:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp133_Ile136delinsAlaAlaAlaAla;Trp151_Leu154delinsAlaAlaAlaAla]' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9H0E2:p.Trp133_Ile136delinsAlaAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain WTHI AAAA Thu Jul 07 12:16:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp133_thr134_his135_ile136ala Fri Jul 22 11:02:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp133ala,thr134ala,his135ala,ile136ala' Wed May 02 19:59:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_thr_his_ile133-136ala_ala_ala_ala' Tue Jun 30 17:43:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp133_Ile136delinsAlaAlaAlaAla' Q9H0E2:p.Trp151_Leu154delinsAlaAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain WYSL AAAA Wed May 02 15:01:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_tyr_ser_leu151-154ala_ala_ala_ala' Tue Jun 30 17:34:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp151_Leu154delinsAlaAlaAlaAla' physical association physical association Fig. 6B map1lc3a-tollip-3 1 15 unspecified role unspecified role neutral component neutral component n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6D tollip-map1lc3a 7 8 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp. Fig. 6A tollip-map1lc3a-2 2 8 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 7I tollip-atg8 5 8 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lipidated residue modres protein modification ModRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 6G