IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A role for the vesicle-associated tubulin binding protein ARL6 (BBS3) in flagellum extension in Trypanosoma brucei. A role for the vesicle-associated tubulin binding protein ARL6 (BBS3) in flagellum extension in Trypanosoma brucei. Biochim. Biophys. Acta (0006-3002) 2012 imex curation Price H.P., Hodgkinson M.R., Wright M.H., Tate E.W., Smith B.A., Carrington M., Stark M., Smith D.F. Diabetes - Interactions investigated in the context of Diabetes Yesterday I could access the Supplementary Figs - but today I cannot (Sorry, your request could not be processed because the format of the URL was incorrect.) If I remember correctly there was nothing to annotate - but I cannot be sure, and cannot check.... T. brucei brucei BSF strain Lister 427 and T. brucei brucei procyclic strain 449. helen.price@york.ac.uk Only protein-protein interactions tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) confocal microscopy confocal microscopy immunostaining immunostaining Price H.P., Hodgkinson M.R., Wright M.H., Tate E.W., Smith B.A., Carrington M., Stark M., Smith D.F. Diabetes - Interactions investigated in the context of Diabetes Yesterday I could access the Supplementary Figs - but today I cannot (Sorry, your request could not be processed because the format of the URL was incorrect.) If I remember correctly there was nothing to annotate - but I cannot be sure, and cannot check.... T. brucei brucei BSF strain Lister 427 and T. brucei brucei procyclic strain 449. helen.price@york.ac.uk Accepted 2012-JUN-21 by ORCHARD Biochim. Biophys. Acta (0006-3002) 2012 Only protein-protein interactions imex curation Deleted Expt-2 as I could not verify Tubulins entered. A role for the vesicle-associated tubulin binding protein ARL6 (BBS3) in flagellum extension in Trypanosoma brucei. A role for the vesicle-associated tubulin binding protein ARL6 (BBS3) in flagellum extension in Trypanosoma brucei. Biochim. Biophys. Acta (0006-3002) 2012 imex curation Price H.P., Hodgkinson M.R., Wright M.H., Tate E.W., Smith B.A., Carrington M., Stark M., Smith D.F. Diabetes - Interactions investigated in the context of Diabetes Yesterday I could access the Supplementary Figs - but today I cannot (Sorry, your request could not be processed because the format of the URL was incorrect.) If I remember correctly there was nothing to annotate - but I cannot be sure, and cannot check.... T. brucei brucei BSF strain Lister 427 and T. brucei brucei procyclic strain 449. helen.price@york.ac.uk Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Price H.P., Hodgkinson M.R., Wright M.H., Tate E.W., Smith B.A., Carrington M., Stark M., Smith D.F. Diabetes - Interactions investigated in the context of Diabetes Yesterday I could access the Supplementary Figs - but today I cannot (Sorry, your request could not be processed because the format of the URL was incorrect.) If I remember correctly there was nothing to annotate - but I cannot be sure, and cannot check.... T. brucei brucei BSF strain Lister 427 and T. brucei brucei procyclic strain 449. helen.price@york.ac.uk Accepted 2012-JUN-21 by ORCHARD Biochim. Biophys. Acta (0006-3002) 2012 Only protein-protein interactions imex curation Deleted Expt-2 as I could not verify Tubulins entered. gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) magnesium(2+) Magnesium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q57uh8_tryb2 Tb927.8.5060 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MGQSKTKLQVVMCGLDNSGKTTIINQVKPAQSSSKHITATVGYNVETFEKGRVAFTVFDMGGAKKFRGLWETYYDNIDAVIFVVDSSDHLRLCVVKSEIQAMLKHEDIRRELPGGGRVPFLFFANKMDAAGAKTAAELVEILDLTTLMGDHPFVIFASNALKGTGVHEGFSWLQETASRQSGKAGTKRG 285FA02A1B51DF91 q38du9_tryb2 BBS1 domain-containing protein Tb09.211.2080 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MPFFSLDRLFIVMRREQLGRNHAEKNQQKEFWIFAFRDRLAGLQAFSNCVEVADIYGNGDNKLIVADASKTLKIYDGTSLSEEIRLSAVPSAITVVFAEAGDDQHLPVIAVSCGPDVFMYRKMKPLYRFTVPCVELDEVDVSVWEQLRNGNISAAEACTRLKERRMAGVKLSTRSADLLALQGTEERERFVQYHKTKPLSEQDVVTCISSLSLDRVEDGGRSCLVIGTETRHIYVLAEKFTGVHHRVRLPGVPTCIVSLGSFRVDYRIVVACRDGCVYTVKNGELADYSIHSDGAIVQIALCENLVAVATTQNTLSYYKLKGKCEMRVFLPSPITGIATLLDSASGKARGVIVALKSGMVRVYVGKTLLHEAQVYGRVTAMKFGRYGREDAALILVMQNGTLVVEMLHRNASFECKRNQDSGPPGEQDVPIPVPPLTNVFVAQAERERAYSIDMHRLFQRDLTMLRLTTAKAYLSLLSDTHKPAVSPKKTAAPAVPMLGNSVRMITSVQGLGPVFRIRAKIQNISKGVLRDLSLVVSCSCTTYKISNSILCVPFLLPSTVSTCEVLVERLDDNAIDEGICLSVTSSHSLSTLAAVDVRLPDAGFIEDNS 60074856F32F53CF q4gyy5_tryb2 Tubulin alpha chain TB927.1.2340 TB927.1.2360 TB927.1.2380 TB927.1.2400 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGAMPSDKTIGVEDDAFNTFFSETGAGKHVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVYHAVGGGTGSGLGALLLERLSVDYGKKSKLGYTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAAMLDNEAIYDLTRRNLDIERPTYTNLNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADMDGEEDVEEY 68BF6E3EFED70D72 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 guanidinium hydrochloride guanidinium (hydro)chloride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q4gyy5-q57uh8 1 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1A guanidinium_h-q57uh8 2 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig 5A denaturation/ loss of folding -causing an increase in tryptophan fluorescence and a red shift of the emission maximum from 350 nm to 356 nm. gtp-magnesium 2 4 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 5B gdp-magnesium 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 5B mant_gtp-magnesium_2 2 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component mant-gtp fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component physical association physical association Fig 5D/F/H The κdiss for N-methylanthranil acid (mant)GTP was found to be 0.0047 s-1 when displaced with unlabelled GDP and 0.0041 s− 1 when displaced with unlabelled GTP. mant_gdp-magnesium_2_ 2 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component mant_gdp fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig 5C/E/G The κdiss for N-methylanthranil acid labelled (mant)GDP was found to be 0.0076 s− 1 when displaced with unlabelled GDP and 0.0093 s− 1 when displaced with unlabelled GTP. q4gyy5-q57uh8-1 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig 6B ARL6 co-localises with the MYCBBS1 protein at the posterior end of the parasite.