matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr The 2019 coronavirus (SARS-CoV-2) surface protein (Spike) S1 Receptor Binding Domain undergoes conformational change upon heparin binding The 2019 coronavirus (SARS-CoV-2) surface protein (Spike) S1 Receptor Binding Domain undergoes conformational change upon heparin binding bioRxiv 2020 imex curation Marco Guerrin, David Fernig, Marcelo Lima, Mark Skidmore Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. m.a.skidmore@keele.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Marco Guerrin, David Fernig, Marcelo Lima, Mark Skidmore Coronavirus - Interactions investigated in the context of Coronavirus m.a.skidmore@keele.ac.uk Accepted 2020-APR-07 AT 08:59 BST AT 08:59 BST by ORCHARD bioRxiv 2020 imex curation The 2019 coronavirus (SARS-CoV-2) surface protein (Spike) S1 Receptor Binding Domain undergoes conformational change upon heparin binding The 2019 coronavirus (SARS-CoV-2) surface protein (Spike) S1 Receptor Binding Domain undergoes conformational change upon heparin binding bioRxiv 2020 imex curation Marco Guerrin, David Fernig, Marcelo Lima, Mark Skidmore Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. m.a.skidmore@keele.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Marco Guerrin, David Fernig, Marcelo Lima, Mark Skidmore Coronavirus - Interactions investigated in the context of Coronavirus m.a.skidmore@keele.ac.uk Accepted 2020-APR-07 AT 08:59 BST AT 08:59 BST by ORCHARD bioRxiv 2020 imex curation fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fgf2-heparin-1 2 4 unspecified role unspecified role bait bait Tag Biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pig-intestinal mucosa pig Pig intestinal mucosa 3 unspecified role unspecified role prey prey purified purified Tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1A This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. cov_2 spike s1 protein-heparin-1 2 4 unspecified role unspecified role bait bait Tag Biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pig-intestinal mucosa pig Pig intestinal mucosa direct interaction direct interaction Figure 1B This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. cov_2 spike s1 protein-heparin-2 1 4 unspecified role unspecified role neutral component neutral component pig-intestinal mucosa pig Pig intestinal mucosa direct interaction direct interaction Figure 2 The 2019 coronavirus (SARS-CoV-2) surface protein (Spike) S1 Receptor Binding Domain undergoes conformational change upon heparin binding. This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review.