IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity. Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity. Signal transduction and targeted therapy 2021 imex curation Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C., Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus pei-hui.wang@connect.hku.hk,machunhong@sdu.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C., Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C. Virus - Publications including interactions involving viral proteins pei-hui.wang@connect.hku.hk,machunhong@sdu.edu.cn Accepted 2021-JUL-02 AT 07:55 BST AT 07:55 BST by KALPANAP Signal transduction and targeted therapy 2021 Only protein-protein interactions imex curation imex curation Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity. Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity. Signal transduction and targeted therapy 2021 imex curation Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C., Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus pei-hui.wang@connect.hku.hk,machunhong@sdu.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C., Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C. Virus - Publications including interactions involving viral proteins pei-hui.wang@connect.hku.hk,machunhong@sdu.edu.cn wujichang19861213@163.com,pei-hui.wang@connect.hku.hk, machunhong@sdu.edu.cn Accepted 2021-JUL-02 AT 07:55 BST AT 07:55 BST by KALPANAP Signal transduction and targeted therapy 2021 Only protein-protein interactions imex curation imex curation Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity. Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity. Signal transduction and targeted therapy 2021 imex curation Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C., Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus pei-hui.wang@connect.hku.hk,machunhong@sdu.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C., Wu Z., Zhang Z., Wang X., Zhang J., Ren C., Li Y., Gao L., Liang X., Wang P., Ma C. Virus - Publications including interactions involving viral proteins pei-hui.wang@connect.hku.hk,machunhong@sdu.edu.cn Accepted 2021-JUL-02 AT 07:55 BST AT 07:55 BST by KALPANAP Signal transduction and targeted therapy 2021 Only protein-protein interactions imex curation imex curation zdhc5_human Palmitoyltransferase ZDHHC5 KIAA1748 ZNF375 Zinc finger DHHC domain-containing protein 5 Zinc finger protein 375 ZDHHC5 protein protein human Homo sapiens Human MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSLEITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSSSSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDPLSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSPDFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTPKDEVQLKTTYSKSNGQPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV 9E4FB0C9AC8EFE28 spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT goga7_human Golgin subfamily A member 7 GOLGA7 GCP16 Golgi complex-associated protein of 16 kDa HDCKB03P HSPC041 protein protein human Homo sapiens Human MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR 00280547DE3702A3 s-golga7-6 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1B golga7-s-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1B zdhhc5-golga7-1 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1B s-93 1 5 unspecified role unspecified role neutral component neutral component partially purified partially purified conditioned medium conditioned medium P0DTC2:p.[Cys1235_Cys1236delinsAlaAla;Cys1240_Cys1241delinsAlaAla;Cys1243Ala;Cys1247_Cys1248delinsAlaAla;Cys1250Ala;Cys1253_Cys1254delinsAlaAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain CC AA certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain CC AA certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain CC AA certain certain sequence position certain certain certain sequence position certain CC AA physical association physical association 1G More cleaved S2 subunits and less dimeric/trimeric S proteins (>250 kD) in the pseudovirions with S-DeltaC-Palm than that of pseudovirions with S-WT were seen. The S-DeltaC-Palm mutant has several C to A mutations and is not palmitoylated. s-94 3 5 unspecified role unspecified role neutral component neutral component partially purified partially purified conditioned medium conditioned medium P0DTC2:p.[Cys1235_Cys1236delinsAlaAla;Cys1240_Cys1241delinsAlaAla;Cys1243Ala;Cys1247_Cys1248delinsAlaAla;Cys1250Ala;Cys1253_Cys1254delinsAlaAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain CC AA certain certain sequence position certain certain certain sequence position certain CC AA certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain CC AA certain certain sequence position certain certain certain sequence position certain CC AA physical association physical association 1G Significantly reduced trimer formation of S protein was detected in S-DeltaC-Palm mutant expressing cells than S-WT expressing cells. The S-DeltaC-Palm mutant has several C to A mutations and is not palmitoylated.