IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-lung Human lung tissue lung electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy antibody detection identification by antibody antibody detection Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Immuno-gold labeling using gold colloid-labeled antibodies. znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn yes 2020 Only protein-protein interactions imex curation imex curation CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The amino acid sequence for the Spike Receptor binding Domain are not given by the supplier (GenScript). Thus a range of possible RBD regions from several publications/suppliers has been entered. znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn Accepted 2020-APR-23 AT 13:17 BST AT 13:17 BST by KALPANAP 2020 Only protein-protein interactions imex curation imex curation CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The amino acid sequence for the Spike Receptor binding Domain are not given by the supplier (GenScript). Thus a range of possible RBD regions from several publications/suppliers has been entered. znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn Accepted 2020-APR-23 AT 13:17 BST AT 13:17 BST by KALPANAP 2020 Only protein-protein interactions imex curation imex curation CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy antibody detection identification by antibody antibody detection Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Immuno-gold labeling using gold colloid-labeled antibodies. znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn Accepted 2020-APR-23 AT 13:17 BST AT 13:17 BST by KALPANAP 2020 Only protein-protein interactions imex curation imex curation CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn yes 2020 Only protein-protein interactions imex curation imex curation CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The amino acid sequence for the Spike Receptor binding Domain are not given by the supplier (GenScript). Thus a range of possible RBD regions from several publications/suppliers has been entered. znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn Accepted 2020-APR-23 AT 13:17 BST AT 13:17 BST by KALPANAP 2020 Only protein-protein interactions imex curation imex curation CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. Signal transduction and targeted therapy 2020 imex curation Wang K, Chen W, Zhou Y, Lian J, Zhang Z, Du P, Gong L, Zhang Y, Cui H, Geng J, Wang B, Sun X, Wang C, Yang X, Lin P, Deng Y, Wei D, Yang X, Zhu Y, Zhang K, Zheng Z, Miao J, Guo T, Shi Y, Zhang J, Fu L, Wang Q, Bian H, Zhu P, Chen Z, Wang K., Chen W., Zhang Z., Deng Y., Lian JQ., Du P., Wei D., Zhang Y., Sun XX., Gong L., Yang X., He L., Zhang L., Yang Z., Geng JJ., Chen R., Zhang H., Wang B., Zhu YM., Nan G., Jiang JL., Li L., Wu J., Lin P., Huang W., Xie L., Zheng ZH., Zhang K., Miao JL., Cui HY., Huang M., Zhang J., Fu L., Yang XM., Zhao Z., Sun S., Gu H., Wang Z., Wang CF., Lu Y., Liu YY., Wang QY., Bian H., Zhu P., Chen ZN. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this was unassigned2393 not added any author as first author often changes on publication. https://doi.org/10.1101/2020.03.14.988345 znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-kidney Human kidney kidney kidney [Renal] electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy antibody detection identification by antibody antibody detection Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Immuno-gold labeling using gold colloid-labeled antibodies. znchen@fmmu.edu.cn,zhuping@fmmu.edu.cn,hjbian@fmmu.edu.cn yes 2020 Only protein-protein interactions imex curation imex curation a0a0n7h510_chlae Basigin BSG protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey GASGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLWGEYSCVFLPEPTGRADIXXXQLDXXXXGTPRVKAVKSSEHVSEGEMAVLACKSESLPPVTDWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELHIENLNMEADPGKYACNGTSSKGTDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDXVLDXDDAGSAPLKSSGQHLNDKGKKVRQRNSS 9D8EDD0613E120FE spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT basi_human Basigin Leukocyte activation antigen M6 Collagenase stimulatory factor Extracellular matrix metalloproteinase inducer 5F7 Tumor cell-derived collagenase stimulatory factor OK blood group antigen BSG UNQ6505/PRO21383 Hepatoma-associated antigen protein protein human Homo sapiens Human MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS D74C37455BF26685 bsg-spike_wcpv-1 2 9 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rbd sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 1A bsg-spike_wcpv-2 3 9 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rbd sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 1C, number 1 bsg-spike_wcpv-3 3 9 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rbd sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 1C, number 2 spike_wcpv-bsg-1 6 9 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rbd sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 1B Ec50=68.83 ug/mL bsg-spike_wcpv-5 4 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component infection infection colocalization colocalization Figure 1E bsg-s-2 5 9 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rbd sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 1D bsg-s-1 1 9 unspecified role unspecified role neutral component neutral component infection infection 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Figure 1E bsg-s-3 7 9 unspecified role unspecified role neutral component neutral component infection infection 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Figure 1E