IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural characterization of the N-linked glycans in the receptor binding domain of the SARS-CoV-2 spike protein and their interactions with human lectins using NMR spectroscopy. Structural characterization of the N-linked glycans in the receptor binding domain of the SARS-CoV-2 spike protein and their interactions with human lectins using NMR spectroscopy. Angewandte Chemie (International ed. in English) 2020 imex curation Lenza MP., Oyenarte I., Diercks T., Quintana JI., Gimeno A., Bosch A., Coelho H., Diniz A., Peccati F., Delgado S., Valle M., Millet O., Abrescia NGA., Palazón A., Marcelo F., Jimenez-Oses G., Jimenez-Barbero J., Arda A., Ereño-Orbea J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus aarda@cicbiogune.es,jjbarbero@cicbiogune.es,jereno@cicbiogune.es The aarda email address was hyperlinked so I assume this must be the (main?) corresponding author - not stated. 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Lenza MP., Oyenarte I., Diercks T., Quintana JI., Gimeno A., Bosch A., Coelho H., Diniz A., Peccati F., Delgado S., Valle M., Millet O., Abrescia NGA., Palazón A., Marcelo F., Jimenez-Oses G., Jimenez-Barbero J., Arda A., Ereño-Orbea J. Virus - Publications including interactions involving viral proteins Lectins, (and expression/purification of): some of these human lectins (specifically DC-SIGN) are NOT mentioned in the stated references (5-7) or at all, so I have assumed they have retained their tag(s) from the bacterial vectors - as have the ones they DO mention. Radiolabelling of the N-glycans on Spike RBD was achieved by adding 13C D-glucose to transfected HEK293F cells. MGL was identified as CLEC10A from pmid:30504228 aarda@cicbiogune.es,jjbarbero@cicbiogune.es,jereno@cicbiogune.es The aarda email address was hyperlinked so I assume this must be the (main?) corresponding author - not stated. Accepted 2020-DEC-08 AT 08:22 GMT AT 08:22 GMT by ORCHARD Angewandte Chemie (International ed. in English) 2020 Only protein-protein interactions imex curation imex curation n-acetyllactosamine N-acetyllactosamine beta-D-Galactosyl-1,4-N-acetyl-D-glucosamine Galb1-4GlcNAcb Galbeta1-4GlcNAcbeta LacNAc N-acetyl-beta-lactosamine N-Acetyllactosamine beta-D-galactopyranosyl-(1->4)-2-acetamido-2-deoxy-beta-D-glucopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) leg7_human Galectin-7 LGALS7 PIG1 HKL-14 PI7 p53-induced gene 1 protein LGALS7B protein protein human Homo sapiens Human MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF F613D3540331C13F spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT sig10_human Sialic acid-binding Ig-like lectin 10 SIGLEC10 SLG2 Siglec-like protein 2 UNQ477/PRO940 protein protein human Homo sapiens Human MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHPWGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHEGEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ mint E1B787F34CF7201A clc10_human C-type lectin domain family 10 member A CLEC10A CLECSF13 CLECSF14 HML C-type lectin superfamily member 14 Macrophage lectin 2 protein protein human Homo sapiens Human MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH D3B7193E2E1F58AF cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 n-acetylgalactosamine N-acetylgalactosamine GalNAc 2-Acetamido-2-deoxygalactose N-Acetylchondrosamine N-Acetylgalactosamine 2-acetamido-2-deoxygalactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI DIP protein P17931 original sequence version: 132 DIP protein P17931 original sequence version: 181 C49DDF6D67AE0C88 leg8_human Galectin-8 LGALS8 Prostate carcinoma tumor antigen 1 Po66 carbohydrate-binding protein protein protein human Homo sapiens Human MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW AA13116AC5C0D69A 3'sln 3'SLN small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lgals3-s-1 1 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 3 and 4 Spike N-linked glycans:- Intensity attenuation was more pronounced for peaks from LDN, LacNAc and 3'SLacNAc (3'SLN). (GalNAc-beta1-4GlcNAc [CHEBI:61190], N-acetyllactosamine [CHEBI:16153 ], alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], respectively) lgals7b-s-1 1 3 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 4 Spike N-linked glycans:-the most perturbed signals correspond to the LDN epitope, with those for LN and 3´SLN also affected to a lesser extent. (GalNAc-beta1-4GlcNAc [CHEBI:61190], N-acetyllactosamine [CHEBI:16153 ], alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], respectively) lgals8-s-1 1 10 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 4 Galectin-8 binds mainly to the 3´SLN epitope (alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513]) of the Spike RBD. cd209-s-9 1 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 4,7 Spike N-linked glycans:- DC-SIGN exhibited selectivity for the two fucosylated terminal epitopes LeX and LDNF. (LewisX:1,4-beta-D-galactopyranosyl-(alpha-1,3-L-fucopyranosyl)-N-acetyl-D-glucosaminyl group [CHEBI:17995] and fucosylated LDN [CHEBI:61864], respectively) clec10a-s-3 1 6 unspecified role unspecified role neutral component neutral component purified purified possible his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 4,7 Spike N-linked glycans:- MGL recognised terminal LDN, its alpha-2-6 sialylated version (6´SLDN), and the fucosylated LDN (LDNF) glycans. (LDN=GalNAc-beta1-4GlcNAc,[CHEBI:61190], 6´SLDN = CHEBI:156514], LDNF=CHEBI:61864], In Figure 1 MGL is stated to have a preference for N-acetyl-galactosamine. s-siglec10-1 1 5 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 4,6 Spike N-linked glycans:- A marked reduction of the cross-peak intensities was seen with terminal 3´SLN and 6´SLN (6'SLacNAc) epitopes. ( alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], and alpha-2,6-linked sialyl -N-acetyllactosamine (6'SLacNAc [CHEBI:17725].) lgals3-s-2 1 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 5 Spike N-linked glycans:- Intensity attenuation was more pronounced for peaks from LDN, LacNAc and 3'SLacNAc (3'SLN). (GalNAc-beta1-4GlcNAc [CHEBI:61190], N-acetyllactosamine [CHEBI:16153 ], alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], respectively) lactose-lgals3-1 1 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Figure 1B, Supp. figure 3, number 1 Text states that:- "The T175-N179 region is hardly modified by LacNAc, but greatly perturbed when LacNAc is alpha-2-3 sialylated." 3'sln-lgals3-1 1 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 3, number 2 Text states that:- "The T175-N179 region is hardly modified by LacNAc, but greatly perturbed when LacNAc is alpha-2-3 sialylated." lgals8-s-2 1 10 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp. figure 4 Galectin-8 binds mainly to the 3´SLN epitope (alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513]) of the Spike RBD. lgals7b-s-2 1 3 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp. figure 5 Most of the protein is affected by the interaction. cd209-s-10 1 7 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component purified purified Asn-343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn-331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp. figure 7 Spike N-linked glycans:- DC-SIGN exhibited selectivity for the two fucosylated terminal epitopes LeX and LDNF. (LewisX:1,4-beta-D-galactopyranosyl-(alpha-1,3-L-fucopyranosyl)-N-acetyl-D-glucosaminyl group [CHEBI:17995] and fucosylated LDN [CHEBI:61864], respectively) clec10a-s-4 1 6 unspecified role unspecified role neutral component neutral component purified purified possible his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp. Figure 8 Spike N-linked glycans:- MGL recognised terminal LDN, its alpha-2-6 sialylated version (6´SLDN), and the fucosylated LDN (LDNF) glycans. (LDN=GalNAc-beta1-4GlcNAc,[CHEBI:61190], 6´SLDN = CHEBI:156514], LDNF=CHEBI:61864], In Figure 1 MGL is stated to have a preference for N-acetyl-galactosamine. Addition of 1 RBD equivalent produced the complete disappearance of all the NMR signals. clec10a-s-5 1 8 competitor competitor competitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified possible his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp. Figure 9 In Figure 1 MGL is stated to have a preference for N-acetyl-galactosamine. The addition of 1 equivalent of GalNAc produced recovery of the NMR signals of the lectin, confirming that the RBD and GalNAc compete for the same binding site.