IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Flavonoid-mediated inhibition of SARS coronavirus 3C-like protease expressed in Pichia pastoris. Flavonoid-mediated inhibition of SARS coronavirus 3C-like protease expressed in Pichia pastoris. Biotechnology letters 2012 imex curation Nguyen TT., Woo HJ., Kang HK., Nguyen VD., Kim YM., Kim DW., Ahn SA., Xia Y., Kim D. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus this is a "carry on drinking tea" publication... The enzyme is only ~80% pure according to the text, and various figures show gels full of "crud" - thus entered as "partially purified". dmkim@jnu.ac.kr 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Nguyen TT., Woo HJ., Kang HK., Nguyen VD., Kim YM., Kim DW., Ahn SA., Xia Y., Kim D. Virus - Publications including interactions involving viral proteins this is a "carry on drinking tea" publication... The enzyme is only ~80% pure according to the text, and various figures show gels full of "crud" - thus entered as "partially purified". FRET based assay, with substrate Dabcyl-KTSAVLQSGFRKME-Edans peptide. A complementary fluorophore (EDANS) and quencher (DABCYL) were attached to either end of a cleavable enzyme substrate (KTSAVLQSGFRKME). Upon enzymatic cleavage of the substrate, the fluorophore and quencher are separated and emission is restored, producing a signal that is directly correlated to the activity of the enzyme. dmkim@jnu.ac.kr Accepted 2020-AUG-10 AT 03:37 BST AT 03:37 BST by KALPANAP Biotechnology letters 2012 Only protein-protein interactions imex curation imex curation p0c6u8-pro_0000338259 3C-like proteinase nsp5 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 3241 3546 8A3486F9E1A9A89D gallocatechin gallate Gallocatechin gallate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) (-)-epigallocatechin 3-gallate (-)-epigallocatechin 3-gallate (-)-epigallocatechin-3-O-gallate [(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl] 3,4,5-trihydroxybenzoate EGCG Epigallocatechin 3-gallate (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) peptide substrate peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) KTSAVLQSGFRKME (+)-dihydromyricetin (+)-dihydromyricetin (+)-Ampelopsin (+)-Dihydromyricetin (2R,3R)-2,3-dihydro-3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-1-benzopyran-4-one (2R,3R)-3,3',4',5,5',7-hexahydroxy-2,3-dihydroflavanonol (2R,3R)-3,5,7,3',4',5'-hexahydroxyflavanone (2R,3R)-dihydromyricetin Ampelopsin Ampeloptin Dihydromyricetin (2R,3R)-3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-2,3-dihydro-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) daidzein daidzein 4',7-dihydroxyisoflavone 7,4'-dihydroxyisoflavone 7-Hydroxy-3-(4-hydroxyphenyl)-4-benzopyrone 7-hydroxy-3-(4-hydroxyphenyl)-4H-1-benzopyran-4-one Daidzein daidzeol isoaurostatin 7-hydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) puerarin puerarin (1S)-1,5-anhydro-1-[7-hydroxy-3-(4-hydroxyphenyl)-4-oxo-4H-1-benzopyran-8-yl]-D-glucitol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) quercetin quercetin 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-1-benzopyran-4-one 3,3',4',5,7-pentahydroxyflavone 3,5,7,3',4'-Pentahydroxyflavone 3,5,7,3',4'-PENTAHYDROXYFLAVONE Quercetin sophoretin xanthaurine 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0c6u8_pro_0000338259-peptide substrate-1 1 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Supplementary Fig 5 (+)_dihydromyricetin-p0c6u8_pro_0000338259-1 1 6 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Table 1, figure 3, number 1 p0c6u8_pro_0000338259-peptide substrate-2 1 9 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Table 1, figure 3, number 2 p0c6u8_pro_0000338259-peptide substrate-3 1 8 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Table 1, figure 3, number 3 p0c6u8_pro_0000338259-peptide substrate-5 1 7 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Table 1, figure 3, number 4 (_)_epigallocatechin 3_gallate-p0c6u8_pro_0000338259-1 1 4 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Table 1, figure 3, number 5 gallocatechin gallate-p0c6u8_pro_0000338259-1 1 3 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 2 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage Table 1, figure 3, number 6