IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The coronavirus endoribonuclease Nsp15 interacts with retinoblastoma tumor suppressor protein. The coronavirus endoribonuclease Nsp15 interacts with retinoblastoma tumor suppressor protein. Journal of virology 2012 imex curation Bhardwaj K., Liu P., Leibowitz JL., Kao CC. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus kanchan@indiana.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bhardwaj K., Liu P., Leibowitz JL., Kao CC. Virus - Publications including interactions involving viral proteins kanchan@indiana.edu Accepted 2020-JUN-29 AT 13:50 BST AT 13:50 BST by LIVIAP Journal of virology 2012 Only protein-protein interactions imex curation imex curation The coronavirus endoribonuclease Nsp15 interacts with retinoblastoma tumor suppressor protein. The coronavirus endoribonuclease Nsp15 interacts with retinoblastoma tumor suppressor protein. Journal of virology 2012 imex curation Bhardwaj K., Liu P., Leibowitz JL., Kao CC. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus kanchan@indiana.edu Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Bhardwaj K., Liu P., Leibowitz JL., Kao CC. Virus - Publications including interactions involving viral proteins kanchan@indiana.edu Accepted 2020-JUN-29 AT 13:50 BST AT 13:50 BST by LIVIAP Journal of virology 2012 Only protein-protein interactions imex curation imex curation The coronavirus endoribonuclease Nsp15 interacts with retinoblastoma tumor suppressor protein. The coronavirus endoribonuclease Nsp15 interacts with retinoblastoma tumor suppressor protein. Journal of virology 2012 imex curation Bhardwaj K., Liu P., Leibowitz JL., Kao CC. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus kanchan@indiana.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bhardwaj K., Liu P., Leibowitz JL., Kao CC. Virus - Publications including interactions involving viral proteins kanchan@indiana.edu Accepted 2020-JUN-29 AT 13:50 BST AT 13:50 BST by LIVIAP Journal of virology 2012 Only protein-protein interactions imex curation imex curation p0c6x7-pro_0000037321 Uridylate-specific endoribonuclease nsp15 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQ 6430 6775 31BD15E3D0B70C6D rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 rb1-rep-1 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ABC domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P0C6X7-PRO_0000037321:p.[Leu331Ala;Cys333Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:24:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu331Ala;Cys333Ala]' c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2c rb1-rep-2 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6X7-PRO_0000037321:p.[Leu331Ala;Cys333Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 16:22:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu331Ala;Cys333Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AB domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2d rb1-rep-3 2 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell P0C6X7-PRO_0000037321:p.[Leu331Ala;Cys333Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:59:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu331Ala;Cys333Ala]' P0C6X7-PRO_0000037321:p.His249Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H A Tue Jun 30 18:43:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His249Ala' c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 4a-c