IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysis of intraviral protein-protein interactions of the SARS coronavirus ORFeome. Analysis of intraviral protein-protein interactions of the SARS coronavirus ORFeome. PloS one 2007 imex curation von Brunn A., Teepe C., Simpson JC., Pepperkok R., Friedel CC., Zimmer R., Roberts R., Baric R., Haas J. Coronavirus - Interactions investigated in the context of Coronavirus This entry was curated with the special contribution of Edoardo, Filippo and Elisa. vonbrunn@lmb.uni,haas@lmb.uni-muenchen.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western von Brunn A., Teepe C., Simpson JC., Pepperkok R., Friedel CC., Zimmer R., Roberts R., Baric R., Haas J. Coronavirus - Interactions investigated in the context of Coronavirus vonbrunn@lmb.uni,haas@lmb.uni-muenchen.de Accepted 2020-MAR-30 AT 09:03 BST AT 09:03 BST by MGT PloS one 2007 Only protein-protein interactions imex curation imex curation Analysis of intraviral protein-protein interactions of the SARS coronavirus ORFeome. Analysis of intraviral protein-protein interactions of the SARS coronavirus ORFeome. PloS one 2007 imex curation von Brunn A., Teepe C., Simpson JC., Pepperkok R., Friedel CC., Zimmer R., Roberts R., Baric R., Haas J. Coronavirus - Interactions investigated in the context of Coronavirus This entry was curated with the special contribution of Edoardo, Filippo and Elisa. vonbrunn@lmb.uni,haas@lmb.uni-muenchen.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined von Brunn A., Teepe C., Simpson JC., Pepperkok R., Friedel CC., Zimmer R., Roberts R., Baric R., Haas J. Coronavirus - Interactions investigated in the context of Coronavirus vonbrunn@lmb.uni,haas@lmb.uni-muenchen.de Accepted 2020-MAR-30 AT 09:03 BST AT 09:03 BST by MGT PloS one 2007 Only protein-protein interactions imex curation imex curation y14_sars Uncharacterized protein 14 ORF14 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAEVVKLPSRYCC p0c6x7-pro_0000037316 Non-structural protein 9 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus NNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ 4118 4230 EC021D1E6D6297A0 spike_sars Spike glycoprotein S E2 Peplomer protein 2 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT DIP protein P59594 original sequence version: 48 ns8a_sars ORF8a protein Accessory protein 8a Protein non-structural 8a 8a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH ns7b_sars Protein non-structural 7b Accessory protein 7b 7b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV p0c6x7-pro_0000037309 Host translation inhibitor nsp1 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG 1 180 B76E7770809587A7 orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 5166F22872915FCB ns8b_sars ORF8b protein Accessory protein 8b Non-structural protein 8b 8b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN p0c6x7-pro_0000037317 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQ 4231 4369 1F48DD3A6874826C ap3a_sars ORF3a protein Protein 3a Accessory protein 3a Protein U274 Protein X1 3a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL DIP protein P59632 original sequence version: 70 ns7a_sars ORF7a protein Accessory protein 7a Protein U122 Protein X4 7a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE ns3b_sars ORF3b protein Accessory protein 3b Protein X2 3b Non-structural protein 3b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQVR p0c6x7-pro_0000037312 3C-like proteinase nsp5 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 3241 3546 8A3486F9E1A9A89D p0c6x7-pro_0000037320 Proofreading exoribonuclease nsp14 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQ 5903 6429 D8E25737EF40967D p0c6x7-pro_0000037314 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQ 3837 3919 A9483D737BE45288 p0c6x7-pro_0000037313 Non-structural protein 6 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQ 3547 3836 7DCA9AE5B20A23E8 p0c6x7-pro_0000037322 2'-O-methyltransferase nsp16 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN 6776 7073 14B6660399D3A801 ncap_sars Nucleoprotein N 9a Nucleocapsid protein protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA mint Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid 43FC8750F1253034 vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV A6D9A31652DDA194 p0c6x7-pro_0000037318 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SADASTFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4370 5301 80FB0EF691E4A10E p0c6x7-pro_0000037319 Helicase nsp13 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQ 5302 5902 3AFB2DC4596DB1F0 vme1_sars Membrane protein M E1 glycoprotein Matrix glycoprotein Membrane glycoprotein 5 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ 275C37085A0215A8 q19qw5_sars Accessory protein 6 ORF6 sars6 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP 70C9150941C759BF p0c6u8-pro_0000338265 Non-structural protein 11 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SADASTFLNGFAV 4370 4382 p0c6x7-pro_0000283841 Non-structural protein 4 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus KIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQ 2741 3240 89658CF8BC0D7725 p0c6x7-pro_0000037315 Non-structural protein 8 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQ 3920 4117 E5D5A7840B20D23A p0c6x7-pro_0000037310 Non-structural protein 2 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGG 181 818 9BA97EAADC3DB26D p0c6x7-pro_0000037311 Papain-like protease nsp3 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGG 819 2740 BBB1A6190358ADDE p0c6x7-pro_0000037321 Uridylate-specific endoribonuclease nsp15 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQ 6430 6775 31BD15E3D0B70C6D rep-ap3a_cvhsa-1 2 ORF3A 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-23 2 NSP4 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-24 2 NSP6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-25 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-pro_0000338265-1 2 NSP11 26 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-26 2 NSP16 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-ap3a_cvhsa-2 2 ORF3A 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-27 2 NSP2 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP3 30 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Nsp3C sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.1 rep-ap3a_cvhsa-3 2 ORF3A 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP3 30 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nsp3C sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.1 rep-orf9b_cvhsa-1 2 NSP3 30 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Nsp3C sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-28 2 NSP7 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP5 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-29 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP5 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-30 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP6 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-31 2 NSP7 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP7 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-32 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP7 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-2 2 NSP7 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-33 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP8 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-3 2 NSP8 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-34 2 NSP6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP9 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-35 2 NSP7 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP9 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-36 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP9 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-ap3a_cvhsa-4 2 ORF3A 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP10 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-4 2 NSP10 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-37 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP12 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-38 2 NSP13 23 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP12 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-ap3a_cvhsa-5 2 ORF3A 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP12 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-5 2 NSP12 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-39 2 NSP7 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP13 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-40 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP13 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-41 2 NSP12 22 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP13 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-42 2 NSP13 23 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP13 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-6 2 NSP13 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-43 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed NSP14 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-7 2 NSP14 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-orf9b_cvhsa-8 2 NSP15 31 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 e-rep-1 2 NSP1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 e-rep-2 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 e-pro_0000338265-1 2 NSP11 26 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 e-e-1 2 E 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 e-ns3b_cvhsa-1 2 ORF3B 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 e-ns7b_cvhsa-1 2 ORF7B 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 e-orf9b_cvhsa-1 2 E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 ap3a_cvhsa-m-1 2 M 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF3A 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-ns7b_cvhsa-1 2 ORF7B 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF6 25 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns7a_cvhsa-s-1 2 S 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF7A 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8a_cvhsa-rep-1 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8A 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8a_cvhsa-rep-2 2 NSP15 31 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8A 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8a_cvhsa-ns8b_cvhsa-1 2 ORF8B 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8A 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8a_cvhsa-orf9b_cvhsa-1 2 ORF8A 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-rep-1 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-s-1 2 S 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-ns7b_cvhsa-1 2 ORF7B 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-ns8a_cvhsa-1 2 ORF8A 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-orf9b_cvhsa-1 2 ORF8B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-y14_cvhsa-1 2 ORF14 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF8B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 orf9b_cvhsa-rep-1 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 orf9b_cvhsa-rep-2 2 NSP14 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 orf9b_cvhsa-ns7b_cvhsa-1 2 ORF7B 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 orf9b_cvhsa-orf9b_cvhsa-1 2 ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 y14_cvhsa-rep-1 2 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF14 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 y14_cvhsa-orf9b_cvhsa-1 2 ORF14 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.1 y14_cvhsa-y14_cvhsa-1 2 ORF14 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ORF14 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-44 1 NSP2 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1, Fig.2A rep-rep-45 1 NSP6 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-rep-46 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-pro_0000338265-2 1 NSP11 26 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-rep-47 1 NSP16 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-ap3a_cvhsa-6 1 ORF3A 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-rep-48 1 NSP5 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP5 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-orf9b_cvhsa-9 1 NSP5 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-rep-49 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP7 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1, Fig.2A rep-rep-50 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP8 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1, Fig.2B rep-rep-51 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP9 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-rep-52 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP12 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1, Fig.2B rep-rep-53 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP13 23 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-rep-54 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP14 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1, Fig.2B e-rep-3 1 NSP1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 e-rep-4 1 NSP8 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 e-e-2 1 E 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 e-ns7b_cvhsa-2 1 ORF7B 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range E 21 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 m-n-1 1 N 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range M 24 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 rep-ns7b_cvhsa-2 1 ORF7B 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF6 25 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 orf9b_cvhsa-rep-3 1 NSP14 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1 orf9b_cvhsa-orf9b_cvhsa-2 1 ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.1, Fig. S1 y14_cvhsa-orf9b_cvhsa-2 1 ORF14 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.1, Fig. S1 y14_cvhsa-y14_cvhsa-2 1 ORF14 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF14 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.1, Fig. S1 orf9b_cvhsa-orf9b_cvhsa-3 1 ORF9B 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1 orf9b_cvhsa-y14_cvhsa-1 1 ORF14 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF9B 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1 y14_cvhsa-y14_cvhsa-3 1 ORF14 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ORF14 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1 rep-rep-55 1 NSP2 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP6 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A rep-rep-56 1 NSP2 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP8 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A rep-rep-57 1 NSP2 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 29 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A orf9b_cvhsa-rep-4 2 ORF7B 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ORF9B 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 orf9b_cvhsa-rep-5 2 ORF7B 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ORF9B 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 ns8b_cvhsa-rep-2 2 ORF7B 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ORF9B 25 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.1 rep-rep-58 1 NSP2 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NSP2 30 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Nsp3N sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1, Fig.2A