IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Hsieh JJ., Zhou S., Chen L., Young DB., Hayward SD. Chromatin - Epigenetic interactions resulting in chromatin modulation proteins were visualised by indirect immunofluorescence using rabbit anti-CIR polyclonal antibody and mouse anti-Flag mAb. Fig. 4C. Diane_Hayward@qmail.bs.jhu.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 ebna2_ebvg Epstein-Barr nuclear antigen 2 EBNA2 BYRF1 protein protein ebvg Epstein-Barr virus (strain B95-8) Human herpesvirus 4 MPTFYLALHGGQTYHLIVDTDSVGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGVPPPPPPPPQRRDAWTQEPSPLDWDPLGYDVGHGPLASAMRMLWMANYIVRQSRGDRGLILPQGPQTAPQAMLVQPHVPPLRPTAPTILSPLSQPRLTPPQPLMMPPRPTPPTPLPPATLTVPPRPTRPTTLPPTPLLTVLQRPTELQPTPSPPRMHLPVLHVPDQSMHPLTHQSTPNDPDSPEPRSPTVFYNIPPMPLPPSQLPPPAAPAQPPPGVINDQQLHHLPSGPPWWPPICDPPQPSKTQGQSRGQSRGRGRGRGRGRGKSRDKQRKPGGPWRPEPNTSSPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPILFPDDWYPPSIDPADLDESWDYIFETTESPSSDEDYVEGPSKRPRPSIQ FF12A76055A91C9D sap30_human Histone deacetylase complex subunit SAP30 30 kDa Sin3-associated polypeptide Sin3 corepressor complex subunit SAP30 SAP30 Sin3-associated polypeptide p30 protein protein human Homo sapiens Human MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH DIP protein O75446 original sequence version: 135 FF84E06B17AFCAC2 cir1_human Corepressor interacting with RBPJ 1 CIR CBF1-interacting corepressor Recepin CIR1 protein protein human Homo sapiens Human MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPGGTHTKVTQRE 5D0C1CBD9C87569D hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 suh_human Recombining binding protein suppressor of hairless J kappa-recombination signal-binding protein RBP-J kappa CBF-1 Renal carcinoma antigen NY-REN-30 RBPJ IGKJRB IGKJRB1 RBPJK RBPSUH protein protein human Homo sapiens Human MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS DIP protein Q06330 original sequence version: 139 DIP protein Q06330 original sequence version: 98 DIP protein Q06330 original sequence version: 154 DIP protein Q06330-1 original sequence version: 154 91E50D2DE9087EDA cir-rbpsuh-1 5 9 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey Q06330:p.Glu233_Phe235delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EEF AAA Thu Apr 12 11:47:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu223ala,gou234ala,phe235ala' Wed May 02 14:28:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_glu_phe233-235ala_ala_ala' Tue Jun 30 17:00:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu233_Phe235delinsAlaAlaAla' Q06330:p.Lys249_Val251delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain KLV AAA Thu Apr 12 11:45:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys249ala,leu250ala,val251ala' Wed May 02 14:27:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_leu_val249-251ala_ala_ala' Tue Jun 30 17:53:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys249_Val251delinsAlaAlaAla' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cir-rbpsuh-2 1 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed 9 unspecified role unspecified role neutral component neutral component chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed colocalization colocalization cir-sap30-1 2 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-632619]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 221-221, sequence length 220 [EBI-632619]41-221 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cir-hdac1-1 6 9 unspecified role unspecified role neutral component neutral component chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed 11 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed colocalization colocalization rbpsuh-q69023-1 3 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hdac2-cir-1 4 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-633391]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 489-489, sequence length 488 [EBI-633391]286-489 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association