IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the nucleosome core particle at 2.8 A resolution. Crystal structure of the nucleosome core particle at 2.8 A resolution. Nature (0028-0836) 1997 imex curation Luger K., Mader AW., Richmond RK., Sargent DF., Richmond TJ. Chromatin - Epigenetic interactions resulting in chromatin modulation orchard Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Luger K., Mader AW., Richmond RK., Sargent DF., Richmond TJ. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2007-JUN-21 by ORCHARD. Nature (0028-0836) 1997 orchard Only protein-protein interactions imex curation h2b11_xenla Histone H2B 1.1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK DIP protein P02281 original sequence version: 91 DIP protein P02281 original sequence version: 111 DIP protein P02281 original sequence version: 126 DA6C122EC8359FD9 h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62799 original sequence version: 90 DIP protein P62799 original sequence version: 50 DIP protein P62799 original sequence version: 53 DIP protein P62799 original sequence version: 68 DIP protein P62799 original sequence version: 91 DIP protein P62799 original sequence version: 109 A9E5DFD3F8B97598 h3c_xenla Histone H3.3C h3-5 h3f3c protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLVTKAAKKCAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQRSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P02302 original sequence version: 74 FE1B7E45DBBC7D95 h2a1_xenla Histone H2A type 1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK DIP protein P06897 original sequence version: 78 DIP protein P06897 original sequence version: 122 09946ABF27FA52A9 a_satellite_hum_dna1 Palindromic DNA fragment derived from human alpha-satellite DNA ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAGGCATGTTCAGCTGAATTCAGCTGAACATGCCTTTTGATGGAGCAGTTTCCAAATAACTTTTGGTAGAATCTGCAGGTGGATATTGAT AF9810DDA9C988D2 h2-h3 1 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association working 22.4 percent, free 30.2 percent 2.80 A table 1