IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. Cell (0092-8674) 2009 imex curation Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 31 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Steptavidin coip data in Fig 1c ignored since 2 biotinylated proteins and impossible to know what is binding to which bait. Its done better in 1D anyway. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Accepted 2010-MAR-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 31 imex curation eed_mouse Polycomb protein EED Eed protein protein mouse Mus musculus Mouse MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein Q921E6 original sequence version: 48 DIP protein Q921E6 original sequence version: 73 DIP protein Q921E6 original sequence version: 98 D2E0A5BA27C0499A ice1_mouse Little elongation complex subunit 1 Ice1 Interactor of little elongator complex ELL subunit 1 Kiaa0947 protein protein mouse Mus musculus Mouse MMPGETHPAAPGPADLARCQGCASLQQNLNEYVEALIALKQKIINTDNLLTEYQKKCDELQFARRENSTLHHQVEQMLQKISPLQKCQEELGSLKAELEEKKSSLKLYQDTHQEYARVKEECLRTDAQKKKLEAKVKKLEEAAVKQTQDFKQLRNEKKILEKEFKKTQERLDEFSKQKNEKELRHIGTQISSDSHGSIDKRKVKVLLKELWLCVNTAHRLSGEGGRRIPEKPAKGSSAARASEQDELLPVQGGPARAADMRSFFSKLSMEMEGDFSSSESAEEELPSGASPSTEHAFCEERHSEVSGQRPDDGNRTNVYDHEHFFDDDLQAAIDFFKLPPPLLSPVPSPPPMASGSLPSSLAPESFFGEFTDSSDSDSVPPRDSMESALEDYTAESRAYFDLLEKIKRSDQYVKKPGSLEATQAVNSLTPLGFVTGRTALGEPSAAASLAQGRHWTESSEFVRDRGDSVEEAERMVEAREVDKSVQVGKGLLKHNRKLWLEMASRGPARKKEAGAGESEICFSSLGKRTFSELIESEGKTLSSKALCPSQSEFSKRTLTDGSASKSPCVTGSGRFQRRERDVRESTPQSGICAAAAGRGHSARLPSSSSATSVPVSVCSNHQTPWPGCVSVGTPAEGTCTEQKSPTRTLNTFLLRSEPTACFPKENDPENSLSTLSPKSKLGTSTFSDWKSRGLESFSTLKSTAKGHSLPQSVFPKPTGGGQCKGRGPGATLILPKSDWTSLARSQAGFTRRSSGSADSTSWHRSDVLRRGSGGSPRASSEYQQRTRLQLEKATPASQNSSLTAMHGPSGESTIPPESNAAAALLPNQVSVITKQARPRRVLGSSLEPWQPHGNTLSPAVNGGKETGLMPSVSACVGDGDPIAQVPEQIADKETPSPEVSVSWRNPICDSPSDSLLAENFSCSTDRKLPFSSEDNIFQCAMNEHLQQKPTKSPQTTQSGASRLEAGELLPSGVTSGVFPAEQVPHGPHHQADTEAPVVARESHSAPQNASAPPVVPSRGPLRARVPTVPVCPSSLSRAEEETQGTSQSSLPGASYCYTGIRERGEEDTEVEDEAVSCSEGEHEAEAVMGRRQQEQAEDSHRPLGDPEAGVGEAGHPSDVGDLTSALEECNLSTLLYIDKLSTSEVVMVLESCQLGDYSSRVSASECASKGSLSEEMNTELRQSEISRKKCGKRLWEEKLLRASEEWAESEGDDSCGRTSCQHAQCPLEVPSDVLTKTGEELDTNPVDCGGTDTEHALLESTHHSQAAEDLTEDALPEETSSPMPHTAELPDPSAVDGGGSSPLSSRSDPEHIQSSYEDEPNSGECLSIGEEGLAEPGELLTLSSDSSTPPRLEQSSDCVAETAFRYQISAVTSEVISVLINKDQDLVIEKGDNWTIISGVAISPGMEQVVLCDTLGDAASSQDQGGLDDGSMEKSPEASPSGPLPQEPPCGGDLSGAQEDISSNGQSANFDKSRLRNRPVKPSIWIRSQIYDQTLETEKVASDHTYYNWKLEPLGKNKPRSKISNKDQASKLAKTLVLNRGEVHLNEVPQPASGEGTNIKLPRSQAQPIMAGTDRSTPTNCSPDTLSKIRQEVGPPLPPLLPPLIATPPRSSQTLSPLVPNSGPSSRSSPAGHVSPLCEVPGPPVLSPWPEELQQASPLDPSPSPSTAAASGRIVSSPLQFCAATPKHALPVPGRLPSCAPGHAAVSGPQQENSVKILDTMYPELSARARTLSLLKGNMQLSRGSTVDGKVLPGRVSALLGLKAITSTSTAFVLTGGSSGADGSQGKSQDSGVQQDAGGKRTLAVSMLRSAKRLRLDNKSPEPDTREVTGEGVPEDPQGGSPLAEVVPAEEEQADVPVCSAASLLRVNPREMAESYNIAITRALRKIAESSFDLLPVIRSHVYVGNISKKPVMRDQEKEVVYEFSTTNKHLGEYLLRSILSELKIQKTSLDHSYIHALCRVYVGICRQLGDLERARLFCYSLLKEDFPESEKLTLFIANMWREVFLSQSAISEAMQLVARQRARGEVLNCLRAFLSWEKNAPIDVGIVVSKLLLTIQLCPKTEFQSSEEFGEDLSANIWEYIFAIDLLCCHQRWIWTHDNIISKELWPVMDKWIKYRKGHSNIAYTPDVIVASVLRLIGRLGQLGLKEGFPTAVKNISSVIGMFIQHAQDEDIPWGVQLAAVYALCDLSPSNPAEISKILEAWRTQTSNAIPSAIVHCLEEVGSLSADGSAGCTSKGDSAP 92C55F104302D8E0 ell_mouse RNA polymerase II elongation factor ELL Eleven-nineteen lysine-rich leukemia protein Ell protein protein mouse Mus musculus Mouse MAALKEARSYGLSCGRVSDGSRVSVFHVKLTDSALKAFESYRAHQDSVSLRPSIRFEGSQGHISIPQPDCPEEVRAFSFYLSNIGRDSPQGSFDCIQQYVSSYGDVHLDCLGSIQDKVTVCATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYMGKKVQFRKPAPGAADAVPSRKRATPINLASAIRKSSGSGASSVVQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDTLDSLLQQVASVNPKDGTCTLQDCMYKSLQKDWPGYSEGDRQLLKRMLMRKLCQPQNATTDSSPPREHGRSASPSQKRPTDFIDPLASKKPRISHFTQRAQPTLNGKLGAPNGHETLLPAPGPTPSDTLSSSHLPPRLEPPRTHDPLADVSNDLGHSTQDYKHQEATPAPAPHLGLPLLTDFPQAEQPTSSSHTHSRPKKKSKKHKDKERPPEERPPAPQPDAPTAPALPPDAPGLNGACDNEPTSSSETPDYLLKYPAISSSEQRQSYKNDFNAEYSEYRSLHARIEQITRRFTQLDAQLRQLSQGSDEYETTRGQILQEYRKIKKTNTNYSCEKRRCEYLHRKLAHIKRLIAEYDQRQLQAWP DECAD56CF19ABF4B ezh1_mouse Histone-lysine N-methyltransferase EZH1 Ezh1 Enx2 Enhancer of zeste homolog 1 ENX-2 protein protein mouse Mus musculus Mouse MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEDGHNDPSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHPVVSASCSNASASAMAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPAQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPAQKKKRKHRLWAAHCRKIQLKKDNNSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCSPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVF DIP protein P70351 original sequence version: 78 43CECFBDF3E49192 jard2_mouse Protein Jumonji Jumonji/ARID domain-containing protein 2 Jarid2 Jmj protein protein mouse Mus musculus Mouse MSKERPKRNIIQKKYDDSDGIPWSEERVVRKVLYLSLKEFKNAQKRQHGEGLAGSLKAVNGLLGNAQAKALGPASEQSENEKDDASQVSSTSNDVSSSDFEEGPSRKRPRLQAQRKFAQSQPNSPSTTPVKIVEPLLPPPATQISDLSKRKPKTEDFLTFLCLRGSPALPNSMVYFGSSQDEEDVEEEDDETEDVKATTNNASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGKEKHSEPRADSRREQASGAQPTAASAAASSAKGLAANHQPPPSHRSAQDLRKQVSKVNGVTRMSSLGAGTNSAKKIREVRPSPSKTVKYTATVTKGTVTYTKAKRELVKETKPNHHKPSSAVNHTISGKTESSNAKTRKQVLSLGGASKSTGPAASGLKASSRLNPKSCTKEVGGRQLREGLRNSKRRLEEAQQVDKPQSPPKKMKGVAGNAEAPGKKASAASGEKSLLNGHVKKEVPERSLERNRPKRAAAGKNMLGKQAHGKTEGTPCENRSTSQPESSHKPHDPQGKPEKGSGKSGWAAMDEIPVLRPSAKEFHDPLIYIESVRAQVEKYGMCRVIPPPDWRPECKLNDEMRFVTQIQHIHKLGRRWGPNVQRLACIKKHLRSQGITMDELPLIGGCELDLACFFRLINEMGGMQQVTDLKKWNKLADMLRIPKTAQDRLAKLQEAYCQYLLSYDSLSPEEHRRLEKEVLMEKEILEKRKGPLEGHTESDHHKFHSLPRFEPKNGLVHGVTPRNGFRSKLKEVGRAPLKTGRRRLFAQEKEVVKEEEEDKGVLNDFHKCIYKGRSVSLTTFYRTARNIMNMCFSKEPAPAEIEQEYWRLVEEKDCHVAVHCGKVDTNTHGSGFPVGKSEPFSRHGWNLTVLPNNTGSILRHLGAVPGVTIPWLNIGMVFSTSCWSRDQNHLPYIDYLHTGADCIWYCIPAEEENKLEDVVHTLLQGNGTPGLQMLESNVMISPEVLCKKGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYNVSETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTISALLDELRDTELRQRRLLFEAGLHSSARYGSHDGNSTVADGKKKPRKWLQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKHGGIENCLNKPTPKRGPRKRATVDVPPSRLPSS DIP protein Q62315 original sequence version: 78 B56E172C5E5745B5 tri35_mouse E3 ubiquitin-protein ligase TRIM35 Trim35 Hls5 Kiaa1098 Mair Macrophage-derived apoptosis-inducing RBCC protein Protein Nc8 Hemopoietic lineage switch protein 5 protein protein mouse Mus musculus Mouse MEPGPSVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRRCVSGCWEVQTTPSCPVCKERAVPGELRTNHTLNNLVETLLREEAEGARWTGRRSPRPCRAHRAPLTLFCLEDKELLCCACQADARHQEHRVQPIKDTAQDFRAKCKNMEHVLREKAKAFWALRRTYEAIAKHNEVQTTWLEGRIRDEFDKLRDFLRVEEQATLDAMKEESRKKHLQAEEKMKQLAEQTEALAREIERLQMEMKEDDMTFLMKHKSRKRRLFCTVEPAPLQPGLLMDACKYLESLQYRVWKKMLGSVESVPFSLDPNTAAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEVDVGGLPTWRVGVVRVQAHAQAQAQADVGGEGHSHSCYHDTRSGFWYLCRTQGVDGDHCMTSDTATAPLVQAMPRRLRVELECEEGELSFYDSERHCHLYTFHAHFGEVRPYFYLGASRGDGPPEPLRICHLRVSIKEELDI 6EBDECF47FB5A528 rbbp4_mouse Histone-binding protein RBBP4 Rbbp4 Rbap48 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 protein protein mouse Mus musculus Mouse MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS DIP protein Q60972 original sequence version: 141 DIP protein Q60972 original sequence version: 117 DIP protein Q60972 original sequence version: 115 B71E2D55A444C360 tr150_mouse Thyroid hormone receptor-associated protein 3 Thrap3 Trap150 Thyroid hormone receptor-associated protein complex 150 kDa component protein protein mouse Mus musculus Mouse MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSVSRSRKRRLSSRSRSRSYSPAHNRERNHPRVYQNRDFRGHNRGYRRPYYFRGRNRGFYPWGQYNRGGYGNYRSNWQNYRQAYSPRRGRSRSRSPKRRSPSPRSRSHSRNSDKSSSDRSRRSSSSRSSSNHSRVESSKRKSTKEKKSSSKDSRPSQAAGDNQGDEAKEQTFSGGTSQDIKGSESSKPWPDATTYGAGSASRASVSDLSPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSNASQMGSSMSGGAGYQSGAHQGQFDHGSGSLSPSKKSPVGKSPPATGSAYGSSQKEESAASGGAAYSKRYLEEQKTENGKDKEQKQTNADKEKLKEKGGFSDADVKMKSDPFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADFHKEELDEHDKDKSKGRKEPEFDDEPKFMSKVIAGASKNQEEEKSGKWESLHTGKEKQRKAEEMEDEPFTERSRKEERGGSKRSESGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGSKGDFSSGKSSFSITREAQVNVRMDSFDEDLARPSGLLAQERKLCRDLVHSNKKEQEFRSIFQHIQSAQSQRSPSELFAQHIVTIVHHVKEHHFGSSGMTLHERFTKYLKRGNEQEAAKNKKSPEIHRRIDISPSTFRKHGLTHEELKSPREPGYKAEGKYKDDPVDLRLDIERRKKHKERDLKRGKSRESVDSRDSSHSRERSTEKTEKTHKGSKKQKKHRRARDRSRSSSSSSQSSHSYKAEEYPEEAEEREESTSGFDKSRLGTKDFVGPNERGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRSREEEWDPEYTPKSKKYYLHDDREGEGSDKWMGRGRGRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDSLQPSAE 40DF483027363B4E rbbp7_mouse Histone-binding protein RBBP7 Rbbp7 Rbap46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein mouse Mus musculus Mouse MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASELEGQGS DIP protein Q60973 original sequence version: 151 0A4A4CD1A8E96815 aebp2_mouse Zinc finger protein AEBP2 Aebp2 Adipocyte enhancer-binding protein 2 protein protein mouse Mus musculus Mouse MAAALADMADLEELSRLSPLSPGSPGPAARGRAEPPEEEEEEDDEEAEAEAVAALLLNGGAGGGAGGGEAETMSEPSPESASQAGGDEDEDEEDDEDEGSSSGGAEEESSAESLVGSSSGGCSGDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGGPGGPGSSGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEESGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRFDILNFPR B08BF191E9C4A289 q921e6-3 Polycomb protein EED Eed EED-4 protein protein mouse Mus musculus Mouse MPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR 794AABBF7BB46B99 morc3_mouse MORC family CW-type zinc finger protein 3 Morc3 Zcwcc3 Nuclear matrix protein 2 Nxp2 Zinc finger CW-type coiled-coil domain protein 3 protein protein mouse Mus musculus Mouse MAAQPPTGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVISDHICLTFTDNGNGMTADKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETMSVGFLSQTYLEVIKAEHVVVPIVTFNKHRQMINLTESKASLAAILEHSLFSTEQKLLAELNAIMGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDETAGRKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIIIRGQKVKTQLVSKSLAYIERDVYRPKFLTRTVRITFGFNCRNKDHYGIMMYHKNRLIKAYEKVGCQLKANNMGVGVVGIIECNFLKPTHNKQDFDYTNEYRLTILALGEKLNDYWNEMKVKKNAEYPVNLPVEDIQKRPDQTWVQCDACLKWRKLPDGIDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHPTYEKTYKKTSKERFRIRQPEILPRILPQINPELLYQTSVSSQSFSPVKESVPRPHLSEVTSPFAARIINLNLASPASEPENSSMKRKLGVHSSILNAKTRRLSNPPVENSSYKNDDDEDVIILEENSTPKPAVDLEVKSDIEVKSEQSHTEQSGIHVDLVSSPKPCVQASSTSTSTSRSDPGITVSTQTDAPGLTVKKEESMEEDMGVRNGTATLSCVGTEAKVQETSAESVDATSHQLQELRSELLVVTQERDDYKRQCQMFTDQIQVLQQRLLEMNDKCVKKEKCHQSTETDAVFLLDSVNGQAESLDHLGSQYQQALQEIERLKRQCSALQQVKSECSQASCTESKSEVDEMAVQLDDVFRQLDKCTIERDQYKNEVQLLEIEKSHIHSQCEELQTEVEQLKSTGQQAAADGSTASNAEEPVSYVDGESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVDVVDEILGQVVEQMSEISST 29EFFF22B7B24C94 stk38_mouse Serine/threonine-protein kinase 38 Stk38 Ndr1 NDR1 protein kinase Nuclear Dbf2-related kinase 1 protein protein mouse Mus musculus Mouse MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRFCCEWEHRIGAPGVEEIKNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK 00E29F8963196750 q921e6-2 Polycomb protein EED Eed EED-1 protein protein mouse Mus musculus Mouse MAGSHARPPRRLGAICDSGGSGGGGGAGSFAAGSGRACLTAVWRRPRPRRQEPGGRRRNMSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR Translation initiates from a non-canonical start codon (GUG). EC7081363459B105 st38l_mouse Serine/threonine-protein kinase 38-like Stk38l Ndr2 NDR2 protein kinase Nuclear Dbf2-related kinase 2 protein protein mouse Mus musculus Mouse MAMTAGATTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGFPPFCSETPQETYRKVMSWKETLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIRERPAAIPIEIRSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL BE7E0CECDB63A8FD bclf1_mouse Bcl-2-associated transcription factor 1 Bclaf1 Btf Kiaa0164 protein protein mouse Mus musculus Mouse MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRIYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTITPQNAPREESRGRSSFYPEGDQETAKTGKFLKRFTDEESRVFLLDRGNIRDKEAPKEKGSEKGRADGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQGKSFATSSHRNTEEEGPKYKSKVSLKGNRESDGFREEKNYKLKETAYIVERPSTAKDKHKEEDKGSDRITVKKEVQSPEQVKSEKLKELFDYSPPLHKSLDAREKSIFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQANKSTSESFIQHIVSLVHHVKEQYFKSPAVTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPSALRKHTRLAGEERGFKEEIQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKPYKDDSKHKGRERDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKDYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDDEETMENNEEKKDRRKEEKE F57E6327B29B8920 ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP 7442C751E13EA24B suz12_mouse Polycomb protein Suz12 Suz12 D11Ertd530e Kiaa0160 Suppressor of zeste 12 protein homolog protein protein mouse Mus musculus Mouse MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAAAAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSKEKALETDGVSGVPKQSKKQKL DIP protein Q80U70 original sequence version: 62 DIP protein Q80U70 original sequence version: 85 DIP protein Q80U70 original sequence version: 84 4A6B6E52D24FAEF2 setx_mouse Probable helicase senataxin Setx Als4 Kiaa0625 SEN1 homolog Amyotrophic lateral sclerosis 4 protein homolog protein protein mouse Mus musculus Mouse MSTCCWCTPGGSSTIDVLKRYASSTGSSEFQTADEDLCYCLECVAEYHRARDEVPFLHEVLWELETLRLVSHFEKSMKAEAEDDDDLYIVDNNGEEQLFDCSGQDFENKLRVPLFEILKYPYLLLHERVNELCVEALCRMEQNNCSFQVFDKYPGIYLFLVHPNEMVRRWAILTARNLGKVDRDDYYDLQEVLTCLFKVIELGLLESPDIYTSSVLEKGKLILLPAHMYDTTNYKNYWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEKQSDDDSMDPFWPALHCFMVILDRLGSKVWGQLIDPIEAFQTIINNESYNREIQNIRNSSIRTKLEPEPHFDDMVTCSQIVYNFNPEKTKKDSGWRSAICPDYCPNMYEEMETLANVLQSDIGQDMRVHNSTFLWFIPFVQSLMDLKDLGVAYIVEVIHHLYSEVKDVLNQTDAVCDKVTEFFILILISVIELHRNKKCLHLLWVSSQQWVEAVVKCAKLPTTAFVRSCEKSPGSTSRGAAIMSSLALHSVQSNSVQLACVQLIRGLLKEGYQLGQQTLCKRFWDKLNLFLRGNLSLGWQLTGQETHELQMCLKQIIRNIKFKMPQYSTFGDSTSTFKTPPSFKEESDKIDRKHKKNIYCLENCSPVSSKEPMKADTHRVLMKVNTTEEENFKQHYIDLNEEEQEPLPAELCLKQKSEALFSESAQEQVKISAEKSGKESSSYAPSNSTSRNGPEWGCDRGVIMSAHSLTDSSSDFMEQVSTSNEDVSLKDGSVGKTSKPSFKLQKDEICAKLSHVIKKQIRKSTLVDNIIDLEENTAISDLENCSGTDGGALKEDSIGHNVPSDPVLDDKHEEQKSQNSSLFKKEIKSEELDNSSSDDEDKLQIQEGRADDDLVSFTEVTDTLVKAPCEGHVKMVVESRDKEMRESTALTSNLVEGQVPHDSSKPLVAGRQIDLCNITLISQTTVIQFPSGLSKQNSFQLQKGDKRCLTANQNSAATCRGQVIVISDSDEEEDEDEDERSSSEENIKQSKACIGKDCSEHRSLAVNASVEKQLVKEEERYPVEFEDSESQVFEFESSSEVFSVWQDHKIDSKNSLQGEQKSYVTHVADSTNNNLGCGDSVSEEVVRNKAEGVKEHAGPHSSVSAEEFCKTGVKKPKRKRYDKVTAEDPQRPSSSVGTDQLPDRRDLTESDLKSADMGMATPSSSVERDSTILQKSTKSRTHSKPVRKVPASKATKKTHSDTRRGQSKSSCYISCRTSPAIVPPKKLRQCPEPTSTVEKLGLKKAPRKAFELSQRSLECIVQLRDHGKTVGVVDAPKKAKLISPQTLSIKNNKKLLTSQDLQFQRLMRSRSHKKRDFDYKNTDTVRVSRIVQGSDVLEADSDEPDDHRVSEPLAISNEKQLAKCMLSKTEVAEASSDPWVTGITCLVNQCESRVLSGGVPTDVVMVSASEDPVDGGAVTVQVGEVASVKAAEPASSSDTDDDDNLFLTQHDPQDMDLCSQLENKTIIVAHKKDTVQREDSLSRPQLESLSITKCKYKDCVETTKNQGEYCPRHSEAKAADDGLFRKPGLPLSVARPLRPTTTKIFSSSSASRTANLSKSLESTTLQQSALKNKSSGAQPNLKVTPPSSMGSQKPVAEVKSLCNIFHFQTPSSSSKQSCKLTFSENRPTSAASPVNILLPSQSIFDTFIKEVLKWKYQMFLNFDKCGAPTSLCQSISRPVPVRFQDCAEYFNVFLPLIILNAFETVAQEWLSSPNKENFYQLQLRKFPADYKKYWEFLIYLNESELAKQLHPKENDLVFLAPEKSYMDRHGMQDCSHYYCGYVHKFRRTSVMRSGKAECSLCIQTQDTLPASVKNLTRCIVISSLVTTQRKLKAMSLLSSRNQLARAVLNPNPMDFCTKDLLTTTSERIVAYLKDFNEDQKKAIETAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLLYRLLTENQRKGHSDENFNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGDINLVRLGPEKSINTEVLKFSLDSQVNHRMKKDLPSHIQEMLRRKEILDAQLDELSRQRALCRGGREMQRQELDEHIAIVSKERQELASKIKEVQGRPQRAQNTIILESHVICCTLSTSGGLLLESAFRGQGGVPFSCVIVDEAGQSCEVETLSPLIHRCNKLILVGDPKQLPPTVISMKAQEYGYDQSMMARFCKLLEENVEQNMIGRLPVLQLTIQYRMHPDICLFPSNYVYNKNLKTNRLTESIRCSSEWPFQPYLVFDVGDGSERRDNDSYINVQEIKLVMEIIKLIKEKRKDISFRNIGIITHYKAQKTMIQKDLEKEFDKKGPAEVDTVDAFQGRQKDCIIVTCVRASAVQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWYELIQDAQKRGAIIKTSDPNYRHDAMKILKLKPVLQRSLTHPPATAPEAPRPQGGLPSNRLDSGLATTSFAASLYHTPSDTVTSKGPERPLLQDRLRDPRLLRRLDAEAKGTFLKDPQPVSPQLPGVVHLLGEPGFPVVFQDLGFVVPPSTAIVAPLGSHRSPMQAEPPPAHPAAAASTSKRKYSDPDAGLSHKREPRAFSGEQGRHGSVTHHVLRSTDWDRRRLDDSSAKRRQFL DIP protein A2AKX3 original sequence version: 45 3036F84EFED4A098 mtf2_mouse Metal-response element-binding transcription factor 2 Mtf2 Pcl2 Zinc-regulated factor 1 Metal-response element DNA-binding protein M96 Metal regulatory transcription factor 2 Polycomb-like protein 2 protein protein mouse Mus musculus Mouse MRDSTGAGNSLVHKRSPLRRNQKTSASLNKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPTSDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAELPLDKESVSENPTLDLPCSIGRTEGIAHSSNTSDVDLTGASSANETTSASISRHCGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEVVKDDEGKEDYQFEELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS DIP protein Q02395 original sequence version: 96 C595438196DC3E0F eed-suz12-1 2 20 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1A, Supp. Tables 1 and 2 eed-suz12-3 2 12 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig. 1A, Supp. Tables 1 and 2 eed-suz12-4 2 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 26 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig. 1A, Supp. Tables 1 and 2 eezh1-suz12-1 2 8 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig. 1A, Supp. Tables 1 and 4 ezh2-suz12-1 2 26 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig. 1A, Supp. Tables 1 and 3 jarid2-suz12-1 2 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain release identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 22 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 23 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 26 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig. 1A, Supp. Tables 1 and 5 mtf2-suz12-1 2 27 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain release identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig. 1A, Supp. Tables 1 and 6 jarid2-eed-1 7 27 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Coimmunoprecipitation of MTF2, JMJ, or EED/EZH2 pulled down the other three components (Figure 1C), suggesting their coexistence in one protein complex. Fig. 1C jarid2-eed-2 7 24 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Coimmunoprecipitation of MTF2, JMJ, or EED/EZH2 pulled down the other three components (Figure 1C), suggesting their coexistence in one protein complex. Fig. 1C jarid2-eed-3 7 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1E mtf2-ezh1-1 7 27 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1D jarid2-ezh1-2 7 12 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1E jarid2-eed-4 7 8 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1E jarid2-ezh2-1 7 24 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1E jarid2-ezh2-2 7 12 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1E jarid2-ezh1-1 7 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1E mtf2-ezh2-1 7 24 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1D mtf2-eed-1 7 27 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To verify binary interactions, we coexpressed V5-tagged MTF2 or HA-tagged JMJ with one of bfEED, bfEZH,1 and bfEZH2 in 293T cells. Both MTF2 and JMJ bind to EED, EZH1, or EZH2 (Figures 1D and 1E). Fig. 1D jarid2-ezh2-3 5 24 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association Fractionation of nuclear extracts from CJ7 ESCs by gel filtration shows that JMJ comigrates with EZH2 with two peaks centered at 3908 kDa and 395 kDa (Figure 1F), Fig. 1F ezh2-jarid2-1 6 25 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey association association Fig. 1G, Supp. Fig. 1A ezh2-suz12-2 6 24 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey physical association physical association Fig. 1G ezh2-jarid2-4 6 12 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined set region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range physical association physical association Fig. 1G eed-jarid2-4 6 8 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Fig. 1G ezh2-jarid2-5 3 12 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey association association Fig. 1H eed-jarid2-5 3 12 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig. 1I eed-jarid2-6 3 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association Fig. 1I Observed in Ezh2 knock-out cells. Interaction with Suz12 is greatly reduced. ezh2-jarid2-2 3 12 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Fig. 1I Observed in Eed knockout cells. ezh2-jarid2-6 4 24 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association Fig. 1J ezh2-jarid2-7 1 24 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association Fig. 1J ezh2-jarid2-8 6 25 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 24 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 14 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 17 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. association association Fig. 4A ezh2-jarid2-9 6 14 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 17 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 25 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 24 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. association association Fig. 4A Jarid2 was additionally isolated with this complex, but cthe presence of 2 flag-tagged bait proteins made this impossible to capture.