IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Antisense RNA Stabilization Induces Transcriptional Gene Silencing via Histone Deacetylation in S. cerevisiae. Antisense RNA Stabilization Induces Transcriptional Gene Silencing via Histone Deacetylation in S. cerevisiae. Cell (0092-8674) 2007 Camblong J., Iglesias N., Fickentscher C., Dieppois G., Stutz F. Chromatin - Epigenetic interactions resulting in chromatin modulation Immunoprecipitated DNA was quantitated by real-time PCR with specific primers francoise.stutz@cellbio.unige.ch 01-April-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ch-ip chromatin immunoprecipitation assay ch-ip full dna sequence full identification by DNA sequencing full dna sequence Camblong J., Iglesias N., Fickentscher C., Dieppois G., Stutz F. Chromatin - Epigenetic interactions resulting in chromatin modulation Immunoprecipitated DNA was quantitated by real-time PCR with specific primers francoise.stutz@cellbio.unige.ch Accepted 2008-MAR-8 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 tba3_yeast_gene Tubulin alpha-3 chain gene gene yeast Saccharomyces cerevisiae Baker's yeast nab2_yeast_gene Nuclear polyadenylated RNA-binding protein NAB2 gene gene yeast Saccharomyces cerevisiae Baker's yeast gtr1_yeast_gene GTP-binding protein GTR1 gene gene yeast Saccharomyces cerevisiae Baker's yeast rrp6_yeast Exosome complex exonuclease RRP6 RRP6 UNC733 Ribosomal RNA-processing protein 6 YOR001W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVPQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLKKKNIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNGPRAAKKRRPAAKGKNLSFKR B19A0B2ED74C6DA7 B19A0B2ED74C6DA7 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE 50365FFF1D3718CE hda1_yeast Histone deacetylase HDA1 HDA1 N2819 YNL021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSVMVKKEVLENPDHDLKRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 4E7069E66D03264D 4E7069E66D03264D pho84_yeast_gene Inorganic phosphate transporter PHO84 gene gene yeast Saccharomyces cerevisiae Baker's yeast h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A A6115FEB480AC67A rrp6-pho84_gene-1 1 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association Transcription of PHO84 appears to decrease as cells age, due to dissociation of Rrp6 from the locus over time Fig 1D, 3B, 5A Interaction requires Hpr1 (P17629) to be present in the cell. rrp6-gtr1_gene-1 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5A Association of transcription factor with gene is reduced in aged cells (15 days). rrp6-tba3_gene-1 1 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5A Association of transcription factor with gene is reduced in aged cells (15 days). rrp6-nab2_gene-1 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5A tbp-pho84_gene-1 1 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Fig 3B Interaction requires Hpr1 (P17629) to be present in the cell. h3-pho84_gene-1 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait lys-19 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association H3K18 acetylation appears to decrease with age of cells Fig 7A, 7B CHiP analysis of histone H3K18 acetylation (H3K18Ac) over the PHO84 locus h3-gtr1_gene-2 1 4 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait lys-19 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association Figs 7A, 7B h3-tba3_gene-2 1 2 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait lys-19 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association Figs 7A, 7B hda1-gtr1_gene-1 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6D Association of Hda1 with gene is increased 5-fold in the absence of rrp6 (Q12149) hda1-tba3_gene-2 1 2 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6D Association of Hda1 with gene is increased 5-fold in the absence of rrp6 (Q12149). hda1-pho84_gene-1 1 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association Fig 6D Association of Hda1 with gene is increased 5-fold in the absence of rrp6 (Q12149).