IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana. Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana. Biochem. J. (0264-6021) 2007 imex curation Yan D., Zhang Y., Niu L., Yuan Y., Cao X. Chromatin - Epigenetic interactions resulting in chromatin modulation It was not possible to ascertain the source organism of the histones or myelin basic protein used in the methyltransferase assay. The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. xfcao@genetics.ac.cn 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yan D., Zhang Y., Niu L., Yuan Y., Cao X. Chromatin - Epigenetic interactions resulting in chromatin modulation The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. xfcao@genetics.ac.cn Accepted 2007-OCT-4 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Biochem. J. (0264-6021) 2007 Only protein-protein interactions imex curation Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana. Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana. Biochem. J. (0264-6021) 2007 imex curation Yan D., Zhang Y., Niu L., Yuan Y., Cao X. Chromatin - Epigenetic interactions resulting in chromatin modulation It was not possible to ascertain the source organism of the histones or myelin basic protein used in the methyltransferase assay. The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. xfcao@genetics.ac.cn 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Yan D., Zhang Y., Niu L., Yuan Y., Cao X. Chromatin - Epigenetic interactions resulting in chromatin modulation It was not possible to ascertain the source organism of the histones or myelin basic protein used in the methyltransferase assay. The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. xfcao@genetics.ac.cn Accepted 2007-OCT-4 by JYOTI. Biochem. J. (0264-6021) 2007 Only protein-protein interactions imex curation anm11_arath Protein arginine N-methyltransferase 1.1 PRMT11 PAM1 Arginine methyltransferase pam1 PRMT1.1 Histone-arginine N-methyltransferase PRMT11 PRMT1B T16L4.20 At4g29510 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKNSNHDENEFISFEPNQNTKIRFEDADEDEVAEGSGVAGEETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLTAIEDSEYKEDKIEFWNSVYGFDMSCIKKKAMMEPLVDTVDQNQIVTDSRLLKTMDISKMSSGDASFTAPFKLVAQRNDYIHALVAYFDVSFTMCHKLLGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGTMSVSPNKKNPRDIDIKLSYSLNGQHCKISRTQHYKMR 9BE43387CD7AE0B2 h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 fbrl2_arath rRNA 2'-O-methyltransferase fibrillarin 2 FIB2 FLP Fibrillarin-like protein 2 Histone-glutamine methyltransferase MED36A MED36_1 L73G19.10 At4g25630 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPPLTGSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKTEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKSGGHFVISIKANCIDSTVPAEAVFQTEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKPKAATAA DIP protein Q94AH9 original sequence version: 65 0E3DF1733F52CFDC anm12_arath Probable protein arginine N-methyltransferase 1.2 PRMT12 PRMT1.2 PRMT1A F6F22.30 At2g19670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSTENNNNGSDETQTTKLHFEDADESMHDGDDNNADVADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEEIELPVPKVDVIISEWMGYFLLYENMLDTVLYARNKWLVDGGIVLPDKASLYVTAIEDAHYKDDKVEFWDDVYGFDMSCIKRRAITEPLVDTVDGNQIVTDSKLLKTMDISKMAAGDASFTAPFKLVAQRNDHIHALVAYFDVSFTMCHKKMGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGSMTIAQNKKNPRDVDIKLSYSLNGQHCNISRTHFYKMR 9C31A654BDCC4C70 prmt1a-h4 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P62805:p.Arg20Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R K Wed May 02 15:33:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg20lys' Tue Jun 30 18:28:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg20Lys' arg20 mearg methylated arginine MeArg certain certain sequence position certain certain certain sequence position certain 6 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined methylation methylation reaction methylation 2C 2D Fluorography results showed that GST-H4R3N1-54 was methylated by GST-AtPRMT1a Methylation of arginine at amino acid position 20. prmt1b-h4 2 3 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P62805:p.Arg20Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R K Wed May 02 16:00:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg20lys' Tue Jun 30 15:49:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg20Lys' arg20 mearg methylated arginine MeArg certain certain sequence position certain certain certain sequence position certain methylation methylation reaction methylation 2C 2D Fluorography results showed that GST-H4R3N1-54 was methylated by GST-AtPRMT1a and GST-AtPRMT1b Methylation of arginine at amino acid position 20. prmt1a-fib2 2 6 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain methylation methylation reaction methylation 6A 6B As shown in Fig.6B, both AtFib2 and its N terminal region AtFib2N1-150 were methylated by AtPRMT1a and AtPRMT1b in vitro, Methylation of AtFib2 The authors state "To determine the type of activity that AtPRMT1a and AtPRMT1b catalyze, GST-AtFib2N1-150 was subjected to Western blot after methyltransferase activity assay transferred onto nitrocellulose membrane and probed with antibody specific for asymmetrically dimethylated arginines. The result demonstrated the presence of asymmetric dimethylation on GST-AtFib2N1-150, suggesting AtPRMT1a and AtPRMT1b are type I arginine methyltransferase." prmt1b-fib2 2 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined methylation methylation reaction methylation 6A 6B As shown in Fig.6B, both AtFib2 and its N terminal region AtFib2N1-150 were methylated by AtPRMT1a and AtPRMT1b in vitro, Methylation of AtFib2 The authors state "To determine the type of activity that AtPRMT1a and AtPRMT1b catalyze, GST-AtFib2N1-150 was subjected to Western blot after methyltransferase activity assay transferred onto nitrocellulose membrane and probed with antibody specific for asymmetrically dimethylated arginines. The result demonstrated the presence of asymmetric dimethylation on GST-AtFib2N1-150, suggesting AtPRMT1a and AtPRMT1b are type I arginine methyltransferase." prm1a-prm1b 1 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 5 A direct interaction was demonstrated between AtPRMT1a and AtPRMT1b as no other signal was detected by MBP monoclonal antibody in any of the control lanes