IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. Cell (0092-8674) 2007 imex curation Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer hyman@mpi-cbg.de 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions 6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation hyman@mpi-cbg.de Accepted 2007-FEB-15 by JYOTI. 02-MAR-2006: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 6 imex curation The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. Cell (0092-8674) 2007 imex curation Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer hyman@mpi-cbg.de 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions 6 caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation hyman@mpi-cbg.de Accepted 2007-FEB-15 by JYOTI. 02-MAR-2006: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 6 imex curation The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. Cell (0092-8674) 2007 imex curation Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer hyman@mpi-cbg.de 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions 6 caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation hyman@mpi-cbg.de Accepted 2007-FEB-15 by JYOTI. 02-MAR-2006: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 6 imex curation The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. The C. elegans RSA complex localizes protein phosphatase 2A to centrosomes and regulates mitotic spindle assembly. Cell (0092-8674) 2007 imex curation Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer hyman@mpi-cbg.de 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions 6 caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Schlaitz AL., Srayko M., Dammermann A., Quintin S., Wielsch N., MacLeod I., de Robillard Q., Zinke A., Yates JR., Muller-Reichert T., Shevchenko A., Oegema K., Hyman AA. Chromatin - Epigenetic interactions resulting in chromatin modulation hyman@mpi-cbg.de Accepted 2007-FEB-15 by JYOTI. 02-MAR-2006: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 6 imex curation spd5_caeel Spindle-defective protein 5 spd-5 F56A3.4 protein protein caeel Caenorhabditis elegans MEDNSVLNEDSNLEHVEGQPRRSMSQPVLNVEGDKRTSSTSATQQQVLSGAFSSADVRSIPIIQTWEENKALKTKITILRGELQMYQRRYSEAKEASQKRVKEVMDDYVDLKLGQENVQEKMEQYKLMEEDLLAMQSRIETSEDNFARQMKEFEAQKHAMEERIKELELSATDANNTTVGSFRGTLDDILKKNDPDFTLTSGYEERKINDLEAKLLSEIDKVAELEDHIQQLRQELDDQSARLADSENVRAQLEAATGQGILGAAGNAMVPNSTFMIGNGRESQTRDQLNYIDDLETKLADAKKENDKARQALVEYMNKCSKLEHEIRTMVKNSTFDSSSMLLGGQTSDELKIQIGKVNGELNVLRAENRELRIRCDQLTGGDGNLSISLGQSRLMAGIATNDVDSIGQGNETGGTSMRILPRESQLDDLEESKLPLMDTSSAVRNQQQFASMWEDFESVKDSLQNNHNDTLEGSFNSSMPPPGRDATQSFLSQKSFKNSPIVMQKPKSLHLHLKSHQSEGAGEQIQNNSFSTKTASPHVSQSHIPILHDMQQILDSSAMFLEGQHDVAVNVEQMQEKMSQIREALARLFERLKSSAALFEEILERMGSSDPNADKIKKMKLAFETSINDKLNVSAILEAAEKDLHNMSLNFSILEKSIVSQAAEASRRFTIAPDAEDVASSSLLNASYSPLFKFTSNSDIVEKLQNEVSELKNELEMARTRDMRSPLNGSSGRLSDVQINTNRMFEDLEVSEATLQKAKEENSTLKSQFAELEANLHQVNSKLGEVRCELNEALARVDGEQETRVKAENALEEARQLISSLKHEENELKKTITDMGMRLNEAKKSDEFLKSELSTALEEEKKSQNLADELSEELNGWRMRTKEAENKVEHASSEKSEMLERIVHLETEMEKLSTSEIAADYCSTKMTERKKEIELAKYREDFENAAIVGLERISKEISELTKKTLKAKIIPSNISSIQLVCDELCRRLSREREQQHEYAKVMRDVNEKIEKLQLEKDALEHELKMMSSNNENVPPVGTSVSGMPTKTSNQKCAQPHYTSPTRQLLHESTMAVDAIVQKLKKTHNMSGMGPELKETIGNVINESRVLRDFLHQKLILFKGIDMSNWKNETVDQLITDLGQLHQDNLMLEEQIKKYKKELKLTKSAIPTLGVEFQDRIKTEIGKIATDMGGAVKEIRKK DIP protein P91349 original sequence version: 99 FDFE3AAB765EA2B9 pp2a_caeel Serine/threonine-protein phosphatase 2A catalytic subunit let-92 F38H4.9 protein protein caeel Caenorhabditis elegans MAAAPPSADPLDKALIVDVDQWIEQLYECKPLSENQVKTLCEKAKEILEKEPNVQEVRCPVTVCGDVHGQFHDLMELFKMGGKSPDTNYLFMGDYVDRGYYSVETVSLLVCLKIRYKDRVTLLRGNHESRQITQVYGFYDECLRKYGNSNVWKYFTDLFDCFPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHSNGLTLISRAHQLVMEGYNWSHDRNVVTVFSAPNYCYRCGNQAAMVELDDDLKYSFLQFDPAPRRGEPHVTRRTPDYFL F159BF8EF35A855E 2aaa_caeel Probable serine/threonine-protein phosphatase PP2A regulatory subunit F48E8.5 Protein phosphatase PP2A regulatory subunit A paa-1 protein protein caeel Caenorhabditis elegans MSVVEEATDDALYPIAVLIDELRNEDVTLRLNSIRKLSTIALALGVERTRNELIQFLTDTIYDEDEVLLVLAEQLGNFTPLVGGPDHVHCLLLPLENLATVEETVVRDKAVESLRKIADKHSSASLEEHFVPMLRRLATGDWFTSRTSACGLFSVVYPRVSPAIKSELKSMFRTLCRDDTPMVRRAAAAKLGEFAKVFEKTAVIEGLHSSLTDLHVDEQDSVRLLTVESAIAFGTLLDKANKKKLIEPILIELFDDKSWRVRYMVAEKLIEIQNVLGEDMDTTHLVNMYTNLLKDPEGEVRCAATQRLQEFALNLPEDKRQNIICNSLLNVAKELVTDGNQLVKSELAGVIMGLAPLIGKEQTVSELLPIYMQLLNDQTPEVRLNIISSLDKVNEVIGAAQLSTSLLPAIVGLAEDGKWRVRLAIVQFMPLLASQLGQEFFDEKLLPLCLNWLTDHVFSIREASTLIMKELTQKFGGQWASTNIVPKMQKLQKDTNYLQRMTCLFCLNTLSEAMTQEQILKEIMPIVKDLVEDDVPNVRFNAAKSLKRIGKNLTPSTLTSEVKPLLEKLGKDSDFDVRYFSEEAKNSLGL E9B6F7DFFEB973E2 g5edl3_caeel Aurora kinase AIR-1 air-1 K07C11.2 CELE_K07C11.2 protein protein caeel Caenorhabditis elegans MSGKENTAPVIDDQKAEVISLTEDSRPQRVDQAREESCWSLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQREDIEVPLFISTLTKSSRNNSTANQ 67839D73430FC9DE p2r31_caeel Serine/threonine-protein phosphatase 2A regulatory subunit rsa-1 rsa-1 Regulator of spindle assembly protein 1 Serine/threonine-protein phosphatase 2A 72kDa regulatory subunit rsa-1 Serine/threonine-protein phosphatase 2A regulatory subunit B'' rsa-1 C25A1.9 protein protein caeel Caenorhabditis elegans MPTDEPSKRKSILPTIPTSLMLKKSNEALSDFERTFNDRVMDIFAENRRIDVEEFKKNAECFLNIIRSNKIDLNWGEGGESRYVTITRLMKILKTSPQSIKDLLPHNTVSNFVKITNYNLTIDITLLEELVRTVIHAEESYIKLLPFSENSTEISSYSLQDFVATHFIPIMIEEPENPVYYTAYAVGTIFFLLGARRRDCVYLKDLLASTLLLQLEECIHAENHCLSPPKIDVFTVAQFRTTLSEFRFLDSQRKGLLAPADLKFFRDGIFNEVFTKRIFEISITYEDGRIDFKAFVDFVTALKFRHTTASAKYHFEILDLKDDGLLDEEEIRSISSFQLQNLPDYVPEDNSVNPEVATAELRDMMRLNQNGITLEEFLANRMNSTFAGFLSNSDDYMKYERREQ AA18C957ABDFDB35 g5ede7_caeel tpxl-1 Y39G10AR.12 1C866 CELE_Y39G10AR.12 protein protein caeel Caenorhabditis elegans MSKSQTIQEFDENFFSSFAVPKVKDYSRLSSSPSRDQPCETSYFENHFPSLECDTPVKMQLPKTKRESDDDLPSPTIDNLLSSSSESTVINASQNDNTEEKQQQPIREPLKIVPNEDASASGSGGENQLIEGLEKLSMFAPKAPEERLSQRRRSEQRKKEEEDKRTSVIAPASGTRSRSISTKRSMSREPAAAAPRAPSVPRPPHNSVTRTISAPIANTGPGVITRAMAARVAENVTKTSVRRSVMPLKVAQKTPVAAVKSDAATAGGDRSRDRTRRTNTTASRRSVFPNKPAAAAANTTPIAPPRRSASANKATAPTSVSKLTPKIRPIATANRSSILRMNVVKPTVPAPAPADAQQNKAASRPAVPAGGAARNRQPLRVNPGTPSTTIKKPPVASSVQRQPPTRARSVDRSGQPPISASTPGKASRADLFNRLATPKVTATPTRTSHEGPASSIRKSAVRPVPSYVYSSYKGMPSAGGLHGIRAPSKDRSTQKPPAAASTPQSKQ 5C65B6FE07FF0C05 rsa2_caeel Regulator of spindle assembly protein 2 Y48A6B.11 rsa-2 protein protein caeel Caenorhabditis elegans MSKIPVFKGSFKSWLAKNDEKPAKSVLLEPKYRDHHEKISFRNKENMEEGEKPVFVSMANPQPTREDYERYDEDRRLKDKARDLRIARRRNSATPEASPSSDQYFTPEPADDEFVTPSTSKKSQKPRSSDATPVSSKPPRYLPRTPLSEQYTSCLSRKMEENFSRMQELMISGHSPHEARQQTIQESSEQLEPRAKVTRSSSQPPPIDTLKPRVPRIESPLVKKTTETPIRRTSYVDTLVATHQIQLQYSDRVVVGVERQMTKLESIKNLAAANRSPIIAEEAKKRRNEAEAVRKLIEVETQNAKKRAVIQELKDRIDKLTQAQLAIHQLVSSQPFSGDPYNQRLLRSIDNWMALPFREFDIQTAREMLELARKMKITIDHFRNVATLHRNSKSLNRSLNTSRKSIAVKINPSSQLNQQSSSDAAPPPSMREASTQMTSRLAESAMTQTSPRRIGVEPLDLSQLLEKHNSSSQTTPPVVEPVLAEVSAEPQRPPVTLSMTAPVSTIAEFDSMLNSISLHNESLETVAEPFSRLKTDISFPSTVEETTPRSGRVSLDSESARRLSAGLSHYLEQVKKERESMEAQESESESMELEIPVVSEVSVTTESENLEEVVSEHSDSKSPETLVASDNGEDSSGGSEDPNATQFEHEIEEHKEPEKLGLIIDPEDEQDETKRFVNHDEFEQSLEEELEPRGNNDSADDSGFLLDNSPAPRLKSIFDNLPPAAASAAVTDTPRVPAEADETTFAGMDMEEYCQREFLKEISPIMVQKAIELQDELRGVDWLTAQDVWQPPSFKDVQMEFDDNFEYFDSFSILIWSAVVDLINKNYLKFGRKMTENEEIAFEAEALKMLQTEHGPESRKSEWCTDVKMSKKLEGMMPMELDYRYDVRRGLPDAEKQKYQWQQVQMTVIAARYANKNLINEANEVYATEKEKLGQMVLESEIDATVTDV D02F9AF1ABDB246B c25a1_9-let_92 4 9 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Table 1 GFP::RSA-1 coprecipitated with the PP2A catalytic and structural subunits LET-92 and PAA-1, indicating that RSA-1 functions as part of a PP2A heterotrimeric complex. In addition to the PP2A core heterodimer, we consistently coimmunoprecipitated the core centrosomal protein SPD-5 and an uncharacterized protein, Y48A6B.11 There are 2 proteins corresponding to Y48A6B.11 (RSA-2). The longer protein Q7YSJ2 has an insertion of SF at position 40-41 compared to the shorter protein (Q9TVY5). y48a6b_11-spd_5 1 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait physical association physical association 2 D, Table S1 we performed a yeast two-hybrid analysis. These experiments suggested that RSA-2 could directly bind to both RSA-1 and the core PCM protein SPD-5 There are 2 proteins corresponding to Y48A6B.11 (RSA-2). The longer protein Q7YSJ2 has an insertion of SF at position 40-41 compared to the shorter protein (Q9TVY5). y48a6b_11-o02217 1 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 2 D, Table S1 we performed a yeast two-hybrid analysis. These experiments suggested that RSA-2 could directly bind to both RSA-1 and the core PCM protein SPD-5 There are 2 proteins corresponding to Y48A6B.11 (RSA-2). The longer protein Q7YSJ2 has an insertion of SF at position 40-41 compared to the shorter protein (Q9TVY5). tpxl_1-o02217 2 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association 6 C There are 2 proteins corresponding to Y48A6B.11 (RSA-2). The longer protein Q7YSJ2 has an insertion of SF at position 40-41 compared to the shorter protein (Q9TVY5). There are 2 proteins corresponding to TPXl-1. The longer protein has MPSAGGLH instead of YEKKRWIY at position 476-482 as compared to the shorter protein (Q8WSN6) and extra residues at the C-terminus (483-507). immunoprecipitation of TPXL-1 resulted in copurification of the RSA complex, as judged by Western blot and mass spectrometry tpxl_1-air_1 3 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Table S2 There are 2 proteins corresponding to Y48A6B.11 (RSA-2). The longer protein Q7YSJ2 has an insertion of SF at position 40-41 compared to the shorter protein (Q9TVY5). There are 2 proteins corresponding to TPXl-1. The longer protein has MPSAGGLH instead of YEKKRWIY at position 476-482 as compared to the shorter protein (Q8WSN6) and extra residues at the C-terminus (483-507). immunoprecipitation of TPXL-1 resulted in copurification of the RSA complex, as judged by Western blot and mass spectrometry q7ysj2-2aaa 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Table S2 There are 2 proteins corresponding to Y48A6B.11 (RSA-2). The longer protein Q7YSJ2 has an insertion of SF at position 40-41 compared to the shorter protein (Q9TVY5). TPXL-1 and RSA-2 were immunoprecipitated with antibodies against the endogenous proteins.