UniProt UniProt http://www.uniprot.org The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. Mol. Cell. Biol. (0270-7306) 2005 Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm chicken bursa lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Accepted 2006-SEP-26 by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. Mol. Cell. Biol. (0270-7306) 2005 Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm chicken bursa lymphoma fluorescence imaging fluorescence microscopy fluorescence imaging polyclonal immunost polyclonal antibody immunostaining polyclonal immunost Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Accepted 2006-SEP-26 by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. Mol. Cell. Biol. (0270-7306) 2005 Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Accepted 2006-SEP-26 by JYOTI. HeLa cDNA library. Mol. Cell. Biol. (0270-7306) 2005 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. Mol. Cell. Biol. (0270-7306) 2005 Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm chicken bursa lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Accepted 2006-SEP-26 by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. Mol. Cell. Biol. (0270-7306) 2005 Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Accepted 2006-SEP-26 by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 o57392_chick centoromere protein C CENP-C protein protein chick Gallus gallus (Chicken) Chicken MAERLDHLKKYYRARFCGQGGKKINIQPGQNVLKYIQDCFECDDTDVTINSPNATSSSTPLVRNQERTSTQSPRPDAGLTIVVGNRTCHSTVSLPATPAETVRSKGEPCVFCPEPGRNSRIADSIKTDSPVHRGETQVLTFKDVEGLCESPAKLSDPEDDPGVVGSPLLVEEAKTPVQTRTVSIAPSSPSPVKDHNVEIESDCEFLIDESGCLSFKSWFSIPRKNRKSQKDGSAAPVLKSQSSDKEKTADKKGKNMNVQAEVHSEQKTKNVRVQRDLKRTSESHPVSSDSEGKVLKSKMQSSTHAGKSKKDALKGSSKHRKKMSYESEAEQLMLSGLDSETSDGEQKIRRVMPREDLAVPSAEHQQEQMLSSKKNLTPCKYQQSASKAYQRSVHKKQTKQTLANDTVLKSQRKKLKKSGKRNGNKNPEPRRWKSSDSEPGEEGLEREPLESNEMFTSPPHQELQTSVLQKLAKSEKAEKVLHALESVTDVNNKTPLKAVELLQHLVDSMKNSEKKRSSVTSSGKMLKKVHHRAHKRACSITRDSEPQNTTDSDSSSAPEVARKKRRQSAVRASKKPKSNRHQRLQHSPAAEKAMGPESGLVLEHSEKYTSPSKHCEENNESSDNSEDLHCQIKNLLSDEIGRQKIVLPSNTPNVRRTKRIRLKPLEYWRGERVTYTLKPSGRLLISGIAGAEAEPHMKNKLKSRHKKKRAKTRSEVVKCLDIPLADASKPTSIVDPVTNQEVLLECINSGSSHSCFFEDESIKVYKSLNTSDFAAGKLILKPLKEKGHQFVHMDTIAFYVIRGQIITTLHKTSYYLTSGDYFYVPAGNGYNIRNLLNEESVLHFTQLKNDRAPVGAELCSVTNENWSLEGKS D345F53B628C63F6 ndc80_chick Kinetochore protein NDC80 homolog KNTC2 Kinetochore protein Hec1 Kinetochore-associated protein 2 NDC80 HEC1 RCJMB04_4o15 protein protein chick Gallus gallus (Chicken) Chicken MRRSSTTSGSSGRQSTMVLRVQDSNKMGLQTPQTKDRGTFGKLSMSKTTSATSERKVSFFGKRASGAGGSRNSQYGMFGTEKIKDPRPLHDKAFIQQCIKQLCEFLVENGYAHNVTIKSLQSPSVKDFIKIFTFIYGFLCPSYELPDSKFEEEIPRVFKELGYPFPLSKSSMYTVGAPHTWPQIVAALIWLTDCFKLYAAMRENPSSFDDGQNWGGETDDGIVHNKLFMDYVVKCYEHFMKGGDTYEELDAEVQSKLKDLFNVDEFKIEGLAAENKRLHEEIARLEKERESEPDRLVSLRKLRSSFQADVQKYQAYLANLESHTTILDQKMKSVNEEVETTEMEVEAMKQENARLQHIFDNQKYSVADIERINHERNELQQTINKLTKELEAEEHQLWNEELKYARNKEAIETQLAEYHKLARKLKLIPISAENSKGHDFEIHFNPEAGPNCLVKYRTQIKAPLMEIVNQTEEEIRKATQRKMSLEDTLEQVNAMVAEKKSSVKTLKEEAEKLDDLYHQKLKEAEEEEQKCANELELLEKHKQLLESGVNEGLSEATNELHDIQRQYQIVMQTTTEESRKAGDNLNRLLEVITTHVVSIEKYLDEQNSKIDRDYEEFMSEDLLSTLTGILDSYKKKAESI FACFED7A0857F71B spc24_chick protein protein chick Gallus gallus (Chicken) Chicken An amino acid sequence which is not represented in UniProt cenph_chick Centromere protein H CENPH protein protein chick Gallus gallus (Chicken) Chicken MAGRLSESVGSGPGAEAETAADPDAKRDVLEHLCARTHLKQLVMEFDTACPPDEGCNSGAEVNFIESAKETLEEVGKVKSAFESKALVIKRIQLMDALRKRVKENDGCARLIVETMRDIIKLNWEIIQAHQQARVIRENLNDIRRKRYFLKQAEGEKALRIFTTVRKKKEVVRMKIAEKLKFIHRNVQYERKVTTLVQNILQNIIVGCQINWAKDPSLRAIILQLEKDISIQNLL 26808B7C1C8A4AC3 ndc80_human Kinetochore protein NDC80 homolog Kinetochore protein Hec1 Kinetochore-associated protein 2 Highly expressed in cancer protein Retinoblastoma-associated protein HEC NDC80 HEC KNTC2 HEC1 protein protein human Homo sapiens Human MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE DIP protein O14777 original sequence version: 126 DIP protein O14777 original sequence version: 132 6A82DA4D8B77ECDC nuf2_chick Kinetochore protein Nuf2 Cell division cycle-associated protein 1 NUF2 CDCA1 RCJMB04_29i8 protein protein chick Gallus gallus (Chicken) Chicken MEALTFPRYSPDDIVAYLRSHVLVGAEARNLTKADLFATLKPEVLHMIFIRILQKVYGIRLEHFYMMPVNVDIVYPQIFEGFLPVCNLYIHMERFLPVCRVNDFQMSDVINPKAKRTARFLSGILNFVHFRECRREAYLELQLNYKSAMEKHQQLETANQELEMKLEKLNTVPVEQQAEFKQLSDDIQELEQLLSHDYRRKTAALQEVISQKKSDITERTRKLNELKVTMATLKEEQEQLKSKIVESPEELKNYKELMKETVKKLKKSKQEVIEKYEGYRDLVEVLPSCQLEVQLYQKKMERQAANVERLASVLSEVRNLEDQLESAQIELKKGKTDEMSLKRLVTAKHERLSTAEIRIKKKREDVEQYKHTVFEYFNRVQEKRGVVYDKVTAIQKEIQQMRFKIQQLNESAEEEEMKAKEIYQNLKAGLEKRHDSLIKTAKNYAASREDKIAELQKGLLRVQSPGSSS 5327A06E09028104 a0a1l1rlv7_chick HORMA domain-containing protein MAD2L1 protein protein chick Gallus gallus (Chicken) Chicken MAAQLSREQQGITLRGSAEIVAEFFSYGINSILYQRGIYPPETFTRVQKYGLTLLVTTDPELKNYLNNVVEQMKEWLYKCTVQRLVVVISSIENNEVLERWQFDIECDKNARGESAPREKSQKAIQDEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLVVPEKWEESGPQFIANSEEVRLRSFTTTIHKVNSMVAYKKDSFP A6D9C718432D0713 spc25_chick protein protein chick Gallus gallus (Chicken) Chicken An amino acid sequence which is not represented in UniProt cenph_human Centromere protein H Interphase centromere complex protein 35 ICEN35 CENPH protein protein human Homo sapiens Human MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM E1BCD4022710168F cenpc_cenph_1 2 6 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fig. 2 cenph_kntc2_1 3 14 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association None. cenph_kntc2_2 5 14 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A cenph_kntc2_3 5 7 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3B cenph_kntc2_4 5 14 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A cenph_kntc2_5 5 9 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3B cenph_kntc2_6 2 7 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 4A cenph_kntc2_7 1 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association Fig. 4B and Fig. 5 kntc2_cenph_1 4 9 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4B cenph_mad2_1 4 12 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4C cenph_spc24_1 4 8 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4C cenph_spc25_1 4 13 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4C