IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Nat. Genet. (1061-4036) 2005 Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au 02-MAR-2006: Contacted by JYOTI. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au Accepted 2007-FEB-6 by DAVET. 02-MAR-2006: Contacted by JYOTI. Nat. Genet. (1061-4036) 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Nat. Genet. (1061-4036) 2005 Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au 02-MAR-2006: Contacted by JYOTI. human-ccrf_cem Homo sapiens T-Acute Lymphoblastic Leukemia cell line ccrf_cem T-Acute Lymphoblastic Leukemia cell line crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au Accepted 2007-FEB-6 by DAVET. 02-MAR-2006: Contacted by JYOTI. Nat. Genet. (1061-4036) 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Nat. Genet. (1061-4036) 2005 Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au 02-MAR-2006: Contacted by JYOTI. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au Accepted 2007-FEB-6 by DAVET. 02-MAR-2006: Contacted by JYOTI. Nat. Genet. (1061-4036) 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Nat. Genet. (1061-4036) 2005 Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au 02-MAR-2006: Contacted by JYOTI. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au Accepted 2007-FEB-6 by DAVET. 02-MAR-2006: Contacted by JYOTI. Nat. Genet. (1061-4036) 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Nat. Genet. (1061-4036) 2005 Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au 02-MAR-2006: Contacted by JYOTI. human-ccrf_cem Homo sapiens T-Acute Lymphoblastic Leukemia cell line ccrf_cem T-Acute Lymphoblastic Leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au Accepted 2007-FEB-6 by DAVET. 02-MAR-2006: Contacted by JYOTI. Nat. Genet. (1061-4036) 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing. Nat. Genet. (1061-4036) 2005 Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au 02-MAR-2006: Contacted by JYOTI. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Harikrishnan KN., Chow MZ., Baker EK., Pal S., Bassal S., Brasacchio D., Wang L., Craig JM., Jones PL., Sif S., El-Osta A. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extract of NIH-3T3 cells were subject to glycerol-gradient fractionation to purify the complex. assam.el-osta@baker.edu.au Accepted 2007-FEB-6 by DAVET. 02-MAR-2006: Contacted by JYOTI. Nat. Genet. (1061-4036) 2005 o35846_mouse Smarca2 brm protein protein mouse Mus musculus Mouse PGPPSVSHPLSTMGSADFPQEGMHQLHKPMDGIHDKGIVEDVHCGSMKGTSMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPISGGGPTPPQMPPSQPGRLIPGDPQAMNQPNRGPSPFSPVQLHQLRAQILAYKMLARGRPLPETLQLAVQGKRTLPGMQQQQQQQQQQQQQQQQQQQQQPQQQQQQPQQPQQQAQAQPQQQQQQQQQPALVSYNRPSGPGQELLLSGQSAPQKLSAPAPSGRPSPAPQAAVQPTATAVPGASVQQPAPG C3372E75E75F7414 smce1_mouse SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 BRG1-associated factor 57 Smarce1 Baf57 protein protein mouse Mus musculus Mouse MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSMAPEEEQVANKAEEKKDEESIPMETEETHLEDTAESQQNGEEGTSTPEDKESGQEGVDSMEVEGTSDSNTGSESNSATVEEPPTDPVPEDEKKE DIP protein O54941 original sequence version: 106 4099B333A0B63709 sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 mecp2_human Methyl-CpG-binding protein 2 MECP2 protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein P51608 original sequence version: 182 DIP protein P51608-1 original sequence version: 195 EB6A33233AEDA566 snf5_mouse SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 Integrase interactor 1 protein Smarcb1 Ini1 Snf5l1 SNF5 homolog Baf47 BRG1-associated factor 47 protein protein mouse Mus musculus Mouse MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW DIP protein Q9Z0H3 original sequence version: 100 DIP protein Q9Z0H3 original sequence version: 94 B7BCA26875BD943D hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP DIP protein P70288 original sequence version: 83 DIP protein P70288 original sequence version: 123 DIP protein P70288 original sequence version: 112 DIP protein P70288 original sequence version: 99 DIP protein P70288 original sequence version: 155 DIP protein P70288 original sequence version: 117 B9843D24A775157C smrc1_mouse SWI/SNF complex subunit SMARCC1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 SWI/SNF complex 155 kDa subunit BRG1-associated factor 155 SWI3-related protein Smarcc1 Baf155 Srg3 protein protein mouse Mus musculus Mouse MAATAGGGPGAAAGAVGAGGAAAASGLAVYRRKDGGPASKFWESPDTVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSSQEDEEWLRPVMRRDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDAPIPEKPWKVHVKWILDTDVFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANSRKRKPSPSPPPPTATESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNPKKDSENTPVKGGTVADLDEQDEEAVTTGGKEDEDPSKGDPSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPIDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGSEEEKMETDPDGQQPEKAENKVENESDEGDKIQDRENEKNTEKEQDSDVSEDVKPEEKENEENKELTDTCKERESDAGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQQHGQTPQQAHQHTGGPGMAPLGATGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQPMPGRMIPAVAANIHPTGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQQQPPPPADGVPPPPAPGPPASATP DIP protein P97496 original sequence version: 93 DIP protein P97496 original sequence version: 103 DIP protein P97496 original sequence version: 95 DIP protein P97496 original sequence version: 117 9030545104B90CAF smca2_human Probable global transcription activator SNF2L2 ATP-dependent helicase SMARCA2 SNF2-alpha SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 SMARCA2 BRM SNF2A SNF2L2 BAF190B Protein brahma homolog BRG1-associated factor 190B protein protein human Homo sapiens Human MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE DIP protein P51531 original sequence version: 66 DIP protein P51531 original sequence version: 126 CE69BBB287D35AB5 mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein Q9Z2D6 original sequence version: 154 62FD228F0118A49F brm-mecp2 6 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association 1a MeCP2 cofractionated with Brm, which is presumed to be part of the larger SWI/SNF complex (Fig. 1a). Western-blot analysis of nuclear extracts also showed that BAF57 and INI1 cofractionated with MeCP2, suggesting that MeCP2 associates in vivo with the Brm-containing SWI/SNF complex. mecp2-brm 4 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association 1b we carried out reciprocal immunopurifications using glycerol-gradient fractions 17−20 followed by western-blot analysis using antibodies to MeCP2 and Brm (Fig. 1b). Results of these analyses are consistent with the existence of a complex containing MeCP2, Brm and BAF57. mecp2-brm-1 4 7 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association 1b we carried out reciprocal immunopurifications using glycerol-gradient fractions 17−20 followed by western-blot analysis using antibodies to MeCP2 and Brm (Fig. 1b). Results of these analyses are consistent with the existence of a complex containing MeCP2, Brm and BAF57. brm-hdac2 3 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 1d we used immunofluorescence to investigate the localization of Brm and MeCP2 in NIH3T3 cells. Staining for the protein determinants showed considerable, but not precise, overlap for Brm and HDAC2 and colocalization of Brm and MeCP2 (Fig. 1d). There is a considerable colocalisation of Brm and HDAC2 fluorescence. brm-mecp2-1 3 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 1d we used immunofluorescence to investigate the localization of Brm and MeCP2 in NIH3T3 cells. Staining for the protein determinants showed considerable, but not precise, overlap for Brm and HDAC2 and colocalization of Brm and MeCP2 (Fig. 1d). brm-ini1 1 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C To examine further whether MeCP2 directly interacts with Brm, we carried out glutathione S-transferase (GST) pull-down experiments using bacterially expressed MeCP2 and in vitro−translated recombinant SWI/SNF subunits. MeCP2 specifically interacted with Brm and INI1 (Fig. 1c), brm-mecp2-2 2 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1g we cross-linked cells with formaldehyde, lysed them and carried out immunoprecipitations for MeCP2 and Brm followed by western-blot analysis. Antibody to Brm immunoprecipitated MeCP2 from soluble cross-linked protein extracts (Fig. 1g); conversely, antibodies to MeCP2 immunoprecipitated Brm. brm-mecp2-3 2 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1g we cross-linked cells with formaldehyde, lysed them and carried out immunoprecipitations for MeCP2 and Brm followed by western-blot analysis. Antibody to Brm immunoprecipitated MeCP2 from soluble cross-linked protein extracts (Fig. 1g); conversely, antibodies to MeCP2 immunoprecipitated Brm. brm-mecp2-4 5 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1g MeCP2 was present in immunoprecipitates of antibody to Brm, as shown by immunoblot assay using an MeCP2-specific antibody3 (Fig. 1g). In a reciprocal assay, MeCP2 was copurified from Brm isolates brm-mecp2-5 5 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1g MeCP2 was present in immunoprecipitates of antibody to Brm, as shown by immunoblot assay using an MeCP2-specific antibody3 (Fig. 1g). In a reciprocal assay, MeCP2 was copurified from Brm isolates