IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Leukemia/lymphoma-related factor, a POZ domain-containing transcriptional repressor, interacts with histone deacetylase-1 and inhibits cartilage oligomeric matrix protein gene expression and chondrogenesis. Leukemia/lymphoma-related factor, a POZ domain-containing transcriptional repressor, interacts with histone deacetylase-1 and inhibits cartilage oligomeric matrix protein gene expression and chondrogenesis. J. Biol. Chem. (0021-9258) 2004 Liu CJ., Prazak L., Fajardo M., Yu S., Tyagi N., Di Cesare PE. Chromatin - Epigenetic interactions resulting in chromatin modulation PEDiCesare@aol.com mouse-c3h10t1_2 Mouse embryonic fibroblast C3H10T1_2 c3h10t1_2 Mouse mesenchymal stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu CJ., Prazak L., Fajardo M., Yu S., Tyagi N., Di Cesare PE. Chromatin - Epigenetic interactions resulting in chromatin modulation PEDiCesare@aol.com J. Biol. Chem. (0021-9258) 2004 Leukemia/lymphoma-related factor, a POZ domain-containing transcriptional repressor, interacts with histone deacetylase-1 and inhibits cartilage oligomeric matrix protein gene expression and chondrogenesis. Leukemia/lymphoma-related factor, a POZ domain-containing transcriptional repressor, interacts with histone deacetylase-1 and inhibits cartilage oligomeric matrix protein gene expression and chondrogenesis. J. Biol. Chem. (0021-9258) 2004 Liu CJ., Prazak L., Fajardo M., Yu S., Tyagi N., Di Cesare PE. Chromatin - Epigenetic interactions resulting in chromatin modulation PEDiCesare@aol.com in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Liu CJ., Prazak L., Fajardo M., Yu S., Tyagi N., Di Cesare PE. Chromatin - Epigenetic interactions resulting in chromatin modulation PEDiCesare@aol.com J. Biol. Chem. (0021-9258) 2004 zbt7a_mouse Zinc finger and BTB domain-containing protein 7A Leukemia/lymphoma-related factor POZ and Krueppel erythroid myeloid ontogenic factor Zbtb7a Lrf Zbtb7 protein protein mouse Mus musculus Mouse MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEFFRSNPMNSLPPTAFPWSGFGAPDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPADRPPAGDGDEGDSTPGLWPERDEDAPPGGLFPPPTAPPATTQNGHYGRAGAGTGEEEAAALSEAAPEPGDSPGFLSGAAEGEDGDAADVDGLAASTLLQQMMSSVGRAGDSDEESRTDDKGVMDYYLKYFSGAHEGDVYPAWSQKGEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGVPPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSGGDDGAGGPAVATAEGNFAT DIP protein O88939 original sequence version: 145 B4F79FF89A88CBD5 hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 zbtb7-hdac1-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association chondrosarcoma FIG. 10. LRF associates with HDAC1 A, LRF associates with HDAC1 in vivo (co-immunoprecipitation assay). Cell extracts were incubated with anti-LRF (lane 2) or anti-HDAC1 (lane 3) antibody or with control IgG (lane 4), followed by protein A/G-agarose. The immunoprecipitated (IP) protein complex and cell extracts (lane 1, which provides a positive control) were examined by immunoblotting with anti-HDAC1 antibody. zbtb7-hdac1-2 2 3 unspecified role unspecified role prey prey in vitro In vitro 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association chondrosarcoma FIG. 10. LRF associates with HDAC1 B, LRF associates with HDAC1 in vitro (GST pull-down assay). Purified GST (lane 2), GST-HDAC1-(51-482) (lane 3), and GST-HDAC1-(1-432) (lane 4) immobilized on glutathione-Sepharose beads were incubated with in vitro translated (IVT) LRF (lane 1). Bound proteins were examined by immunoblotting with anti-LRF antibodies.