UniProt UniProt http://www.uniprot.org Repression of E2F1-mediated transcription by the ErbB3 binding protein Ebp1 involves histone deacetylases. Repression of E2F1-mediated transcription by the ErbB3 binding protein Ebp1 involves histone deacetylases. Nucleic Acids Res. (0305-1048) 2003 Zhang Y., Woodford N., Xia X., Hamburger AW. Chromatin - Epigenetic interactions resulting in chromatin modulation 4A and B yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang Y., Woodford N., Xia X., Hamburger AW. Chromatin - Epigenetic interactions resulting in chromatin modulation 4A and B Accepted 2006-AUG-15 by DAVET. Nucleic Acids Res. (0305-1048) 2003 pa2g4_human Proliferation-associated protein 2G4 PA2G4 Cell cycle protein p38-2G4 homolog ErbB3-binding protein 1 EBP1 protein protein human Homo sapiens Human MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD DIP protein Q9UQ80 original sequence version: 148 CD45466507AD6047 hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA pa2g4-hdac2-1 1 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-924951]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 395-395, sequence length 394 [EBI-924951]317-395 ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association